KEGG   Pelobacter carbinolicus: Pcar_2069Help
Entry
Pcar_2069         CDS       T00285                                 

Definition
protein disulfide bond isomerase, DsbC/DsbG-like, one heme-binding site
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pca  Pelobacter carbinolicus
Brite
Enzymes [BR:pca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pcar_2069
Secretion system [BR:pca02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pcar_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2409629..2410438)
Genome map
AA seq 269 aa AA seqDB search
MWRGYTMKLLVTVVLLFCASTVWAFPKDSCGEKTCIDCHTLSKEEAKYLLDKQADKVLNI
EPSQVQALWVVEVEKKGKRYPVYIDFTKNFVMRGEVLRLKDGENLTRERIASLNRIDVAT
IPLADALLLGKASASKKIIVFTDPQCSYCKKLHAEMKKVVKLDPDVAFYIKMLPLNIHPE
AYMIAKSIVCNRSVAMLEQSFAGRPVPPPVCRAEAVDQTIVLARKSGINSTPTVVLPDGR
PFSGYRDAATLLKMVGSKVQVPKEVGDTE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtggagaggatataccatgaaattgctggtcactgttgttcttttgttctgcgcttcg
acggtctgggctttcccaaaggatagctgcggcgaaaagacctgtatcgactgtcatacc
ctgagcaaggaggaagcgaagtatctgctcgataaacaggccgacaaggttttgaatatc
gaaccgtcccaggtgcaggccctgtgggtggtcgaggttgagaaaaagggcaagcgttac
cccgtctatatcgacttcaccaaaaacttcgtcatgcgcggcgaagtgctccgtctcaaa
gacggggaaaacctcacccgggaacgcattgccagtcttaatcggatcgatgttgctacc
attcctctcgccgatgcgttattgctcggcaaagcttcggcctccaaaaaaatcatcgtg
tttaccgatccgcagtgcagctattgcaaaaagctccatgccgagatgaaaaaggtcgtg
aagctcgatcccgacgtggccttctatattaagatgctgcctctcaatattcatcccgaa
gcttacatgatcgccaagagcatcgtctgtaaccgctcggtcgccatgctcgagcagagc
ttcgcaggccgcccggtaccgccgcccgtttgtcgcgccgaagccgtcgaccagaccatc
gttctggcgcgtaagtccggcatcaattcgaccccgacggtagttcttcccgacggcagg
cccttttccggttatcgcgatgctgcgacattgcttaagatggtcggttccaaagttcag
gtgccgaaagaagtaggcgatactgagtaa

DBGET integrated database retrieval system