KEGG   Pelobacter carbinolicus: Pcar_2241Help
Entry
Pcar_2241         CDS       T00285                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcar_2241 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcar_2241 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcar_2241 (trpA)
Enzymes [BR:pca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcar_2241 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2615166..2615927
Genome map
AA seq 253 aa AA seqDB search
MLETTIRNKLAQKDILLMTHIVIGYPDLDTSFEVVRTMVEAGVDLMELQIPFSEPMADGP
VILKANQDALATGITVDECFDFAEKVAAAYDIPFLFMTYYNILFKYGVEAFAERMAKCGL
CGAIVPDLPPEEADDYLAAMNKHGMAPIFIYAPNTTEARMQRIAEHGKGFIYCMARKGVT
GLQTDFSGQLGDHLDHCRASTQLPLALGFGVKDRADVEFIKGKADIAVVGSQAIRVLDEG
GVPAVEAFIRSLR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagacgaccatccgcaacaaactggcgcaaaaggatatcctgctgatgacccat
atcgtcatcggctacccggatctggacacctctttcgaagtggtccgcaccatggtggag
gccggggtcgacctgatggaattgcagatccccttttccgagccgatggccgacggaccg
gtaatcctcaaggccaaccaggacgccctggccaccggcatcaccgtcgatgagtgcttc
gatttcgcggaaaaggtcgccgcagcctacgacatcccgtttctgttcatgacctattac
aacatcctgttcaaatacggggtcgaagcgtttgccgaacgcatggccaaatgcggattg
tgcggagctatcgtgcccgacctgccgccggaagaggccgacgactatttggcggccatg
aacaaacacggcatggcgccgatcttcatctacgcccccaataccaccgaagcccgcatg
cagcgcatcgccgaacacggcaaaggtttcatctattgcatggcgcgcaagggggtcacg
gggctgcagaccgatttttccggacagctcggcgatcatctggaccattgccgcgcttcg
acgcagctgccgctggccctcgggttcggcgtcaaggatcgcgccgatgtggagtttatc
aaaggcaaagccgatatcgccgtggtcggctcccaggctatccgggtgttggatgaagga
ggcgtgccggcggtggaagcatttatccgcagtctacgttaa

DBGET integrated database retrieval system