KEGG   Pelobacter carbinolicus: Pcar_2580Help
Entry
Pcar_2580         CDS       T00285                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00330  Arginine and proline metabolism
pca00332  Carbapenem biosynthesis
pca01100  Metabolic pathways
pca01130  Biosynthesis of antibiotics
pca01230  Biosynthesis of amino acids
Module
pca_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pcar_2580 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Pcar_2580 (proB)
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Pcar_2580 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABA89818
JGI: Pcar2580
UniProt: Q3A1D9
Position
complement(3028311..3029432)
Genome map
AA seq 373 aa AA seqDB search
MRKDLLSQVKRIVIKVGSGVIFGQDGLDLDVIGSLSRDICALLSQGYEVVLVSSGAVATG
KGELGIVGRPPTIPLKQAAAAIGQSRLMRAWKDAFRPCGRCVGQILLTRDDLANRRRFLN
ARNTLMTLLEYGVVPVINENDTVVVEEIRFGDNDNLSALTTSLAEADLLIILSDVNGLYD
SNPKTNPAARKFSVIERITEDIEQMAGGAGSVVGTGGMATKVEAAKRATLYGVGTIIVDG
RQAGVLPKLMAGEELGTFFLPVPQHMTARKHWISFSKASRGKLLVDEGARRAVAEKGKSL
LPSGIFSIEGKFDRGDAVRICDAEGRVFAKGIASYSRQELERIMGRNSSEIEVVLGYKYG
DEVVHRDNLVVKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaagaccttttgtcccaggttaaacggatcgttatcaaggtcggtagcggagtg
attttcggtcaggatggactcgatctcgacgtgatcggttccttgtcccgggatatctgc
gcgttgctttcccagggctacgaggtggtgctggtctcttccggcgctgtggctactggc
aagggcgaactcggcattgtcggtcggccgcccaccatccccctcaaacaggcggccgcc
gccatcggccaaagccgtctgatgcgggcctggaaggatgccttccgcccgtgcggtcgt
tgcgtggggcagatccttctcacccgggacgatcttgcgaaccgccgacggtttctcaat
gcccgcaacaccctcatgacgcttcttgagtacggcgtggttccggttatcaacgaaaac
gacacggtggtggtcgaggagatccgtttcggggataatgataatctatccgctttgacc
acttcgctggccgaggccgatctgctgatcattctgtcggacgtgaacggcctctacgac
agcaatcccaaaaccaatcctgccgcgcggaagttttcggtgatcgaacgtatcacggaa
gacattgaacaaatggccgggggagccggttccgtggtaggtaccggggggatggcaacc
aaggtcgaggccgccaagcgggcgacgctttacggcgtcggaaccattattgtcgacggg
cgccaggcgggagtgttgcccaaactcatggccggcgaggaactgggaaccttctttctg
ccggtgccccagcacatgacggctcgcaaacactggatttctttcagcaaggccagtcgc
ggtaaattgctggtcgacgaaggcgcacgccgggccgtggcggaaaaaggaaaaagtctc
ttgccttcggggattttctctatcgagggcaagttcgatcgcggcgatgcggtgcgtatc
tgcgatgccgaagggcgcgtcttcgccaaaggcatcgccagttattcgcggcaggaactg
gaacgtatcatggggcgcaactcgtcggaaatcgaggttgttctcggctataaatacggc
gatgaggtggttcatcgcgataacctggtggtaaaaaaatga

DBGET integrated database retrieval system