KEGG   Pelobacter carbinolicus: Pcar_2596Help
Entry
Pcar_2596         CDS       T00285                                 

Gene name
rmlC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00521  Streptomycin biosynthesis
pca00523  Polyketide sugar unit biosynthesis
pca01130  Biosynthesis of antibiotics
Module
pca_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pcar_2596 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_2596 (rmlC)
Enzymes [BR:pca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pcar_2596 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABA89834
JGI: Pcar2596
UniProt: Q3A1C3
Position
3046382..3046924
Genome map
AA seq 180 aa AA seqDB search
MNKIETELSEVFMIEPKIFGDQRGFFFESFNQKQWQNTTGLSTRFVQDNHSRSARGVLRG
LHYQIEQVQAKLVRVIVGEVFDVAVDIRRHSPTFGKWVGVRLSAENKRQLWIPEGFAHGF
LVLSEVAEFLYKTTDYYAPEHERAIIWNDPDLAIHWPTDEEPTLSEKDKRALPLNEAELF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattgaaacggaactttctgaggtttttatgatcgaaccgaaaatcttcggc
gatcagaggggtttcttcttcgaaagcttcaaccagaaacagtggcaaaacacgacgggc
ctgagcacccggttcgtccaggacaatcattcccgatccgccaggggcgtgttaaggggg
ctgcattaccagatcgagcaggttcaggccaaattggtacgcgtcatcgtcggcgaggtc
ttcgatgttgccgtggacatccggcgacactccccaacgttcggcaaatgggtcggagtc
cgcctatccgccgaaaacaaacgccagctgtggattcctgaaggctttgcgcatggtttt
ctcgtgctgtccgaggtggcggagttcctgtacaagaccacggattattatgcccccgaa
catgaaagagccattatctggaacgatccggatcttgccattcactggcccaccgacgaa
gaaccgacgctgtcggagaaagacaaaagggctttacctttaaacgaggccgagcttttt
tag

DBGET integrated database retrieval system