KEGG   Pelobacter carbinolicus: Pcar_2729Help
Entry
Pcar_2729         CDS       T00285                                 

Definition
type III restriction-modification system, restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
pca  Pelobacter carbinolicus
Brite
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Pcar_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3186393..3189122)
Genome map
AA seq 909 aa AA seqDB search
MKLKFKVQPYQTNAVEAVVDCFAGQVNTSRIKYRVDPGMVKDKAGRGQDSLLEVEGFKNA
DIQLSGLQLLDNIRAVQRRQNLFMSNSLVKSAGCDINLDVEMETGTGKTYCYIKTIFEMN
KRYGWSKFIVVVPSVAIREGVYKSLEITADHFTENYGKKARFFIYNSKQLHHLESFSSDA
GINVMVINIQAFASRGADNRRIYDELDDFQSRKPIDVIAANRPILILDEPQKMEGRATLE
SLAKFNPLMILRYSATHRTTHNKVHRLDALDAYNQKLVKKIAVRGITVKGLAGTNAYLYL
ESIEISKQAPVARIELEVKLKSGGIRRRIVRLEKGADLFAQSNELDQYRGFVISQIDATK
DTVEFTNGHELRAGDATGDVTEGTIRRIQIRETIKAHLEKERKLFSQGIKVLSLFFIDEV
AKYRDYDQTDDKGEYARIFEEEYQLLKQETLGELVFDNEEYRKYLDNILPERTHNGYFAI
DKKTKQFKDPKFKTRGQNAGLSDDVDAYDLILKDKERLLGFEEPTRFIFSHSALREGWDN
PNVFVMCMLKHSDNTISRRQEVGRGLRLCVNEQGDRMDHPAIVHDINVLSVVASESYKDF
VANLQQEISDSLSARPRKADEAYFTGKILTTESGQMEVTPAMAKQLYRYLLKNDYTDDAD
QVTEEYHAAKGNGELAKLPDELAPYADQIFLLVDSVFSDALLPKPEDDRGPKTNPLNDNF
KKKEFQELWSRINRKAVYRVDFDSDELVRKCVAALNQDLRITPLQYRIQAGIQSANLTDE
QLKKGQGFVVSDTSTEAHNASVLSMVKYDLLGKLAENTQLKRKTVAEILSGIEAVAFGQF
KTNPEHFISEASRLIKEQKASVIIKRLSYDETTEVHDADIFTAAQTKQDFTRASEKLKNH
IYDYVLGPG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaagttcaaagtccagccctatcagaccaacgccgttgaggcggtggtggat
tgctttgccgggcaggtgaatacatcgcgaatcaagtaccgtgtcgatcccggcatggtc
aaagacaaggccggcagggggcaggacagtctgcttgaggttgagggtttcaagaacgct
gatatccagctatccggtcttcagttgctggacaatatccgtgccgtccagcggcgacag
aatctgtttatgtccaattcgctggtgaaaagcgcggggtgcgatatcaaccttgatgtc
gagatggagaccggcaccggtaagacctactgctacatcaaaaccattttcgagatgaac
aagcggtacggctggtccaagttcatcgtggtcgtcccgagcgtcgccatccgggaaggg
gtctacaagtcgctggagataaccgccgatcactttaccgagaactacggaaagaaagcc
cggttctttatctacaactccaaacagctccatcacctggaaagcttttcctctgacgcc
ggcatcaacgtcatggttatcaacatccaggcgtttgcatcacgcggcgccgacaatcgc
cgcatttatgatgaactggacgatttccaatcccgcaagcctatagatgttatcgccgct
aaccggccgattctgatcctggatgagccacagaaaatggaggggagagctacgctggaa
tctctggcaaaattcaaccctttgatgattttgcgctattccgcgacccatcgcaccacc
cacaacaaggtccatcgcctcgatgctctggatgcctacaaccagaagctggtgaaaaag
attgccgtgcggggcattacagtcaagggcttggccggaaccaatgcctatctttatctg
gagtcgatcgaaatctcgaaacaagccccagtggctcgtattgaactggaggttaaactc
aaatcgggtggaatccgaaggcggatcgtccggctggaaaaaggggcggatcttttcgcc
cagagcaatgagcttgaccaataccgcggattcgttatctcccaaatcgacgctaccaag
gataccgttgagttcactaacggccatgagttgcgggctggagatgcaacgggggacgtg
acggaaggaaccattcgacgtatacagatccgcgaaaccatcaaagcgcacctggaaaag
gagcggaagcttttctcccaggggatcaaggtcctgtcgctgtttttcatcgacgaagtt
gccaaatatcgagattacgatcagacggatgacaaaggggagtatgcgcgcatcttcgag
gaggagtatcaactgctcaaacaggagacccttggggagttggtattcgacaacgaagaa
taccgcaaatatctcgataacatcctgcctgaacggactcataacgggtacttcgccatc
gacaagaaaaccaagcagttcaaggaccctaaatttaaaacgcgtggccagaatgcggga
ttgtcggatgatgtcgatgcctatgatttgattctcaaagacaaggaacgcttgctgggg
tttgaagagccgactcgatttattttttcccactccgcattaagggagggctgggataat
ccaaacgtttttgtcatgtgcatgctcaagcacagcgacaataccatctcgcgccgtcag
gaggttggccgagggctacggctgtgcgtcaatgagcagggcgaccgcatggatcatcct
gccattgtccatgacatcaacgtcctttcggtggttgccagcgagagttacaaagacttt
gtggccaatttgcagcaggaaatcagtgattcgttgtctgcacgcccgagaaaggcggac
gaagcatactttacgggcaaaatcctgacgaccgaatccggccagatggaagtcacgccg
gcaatggccaagcagctctatcgctacctgctcaagaatgattacaccgacgatgcggac
caggttacggaggaataccatgcggccaaaggcaacggcgagctggcaaaactccccgat
gagttggctccttatgccgatcaaattttcctcttagtcgatagcgtcttcagtgatgcg
ctgctgcccaaaccagaagacgacagaggcccaaaaaccaatcctctgaatgacaatttc
aagaaaaaggagttccaggaactctggagtcgaatcaatcgcaaggcggtataccgggtc
gattttgactcggatgagttggttcggaaatgtgtcgcggccttgaaccaggatctgagg
atcacgcccctgcagtacaggattcaggctggaatccagagtgccaacctgaccgacgag
cagctcaaaaaagggcagggcttcgttgttagcgatacatcgaccgaagcgcataatgca
tcggttctctccatggtgaagtacgaccttcttggaaagcttgccgaaaacactcaactg
aaacgcaagacggtcgcggaaattctcagcggcattgaggctgtcgcattcggccaattt
aaaaccaacccggaacacttcatctcggaagcgtctcggttgatcaaagagcagaaggca
tccgtcattattaagcggctcagttacgacgaaactaccgaggtgcatgacgccgacatt
tttaccgctgcacaaaccaagcaggatttcacccgagcgagcgagaagctcaaaaaccac
atttacgattacgtgttgggtcccggatga

DBGET integrated database retrieval system