KEGG   Pelobacter carbinolicus: Pcar_2747Help
Entry
Pcar_2747         CDS       T00285                                 

Definition
SGNH-hydrolase, lysophospholipase L1-like subgroup
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pca  Pelobacter carbinolicus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pcar_2747
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pcar_2747
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pcar_2747
Lipid biosynthesis proteins [BR:pca01004]
 Fatty acid synthase
  Component type
   Pcar_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3205800..3206387
Genome map
AA seq 195 aa AA seqDB search
MTKRSVRILAFGDSLTAGWGVEPPSSVPACLEASLQKQGIATTFINEGIPGDTTVGALKR
FDAALACDPDLVILELGANDNRQAIPLDRTRANLNSMLQTLCDRQIPTLFAGICLLRDLG
PEYNAGFQALFAELATHHKVVFYPDYLEGVAGHPALLQKDQLHPNLAGTQKIARRLLPLV
TDMIRKFETDQSAPL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgatccgttcgcattctggcttttggcgacagtttaacagccggttggggt
gtagagccccccagcagcgtacccgcctgcctggaagcctccttgcagaagcagggcatc
gcaaccacctttatcaacgaaggtatcccgggagacaccactgtgggagcattgaaacgc
tttgatgcggcgcttgcctgcgatcccgacctggtcattctcgaactgggagccaacgac
aaccggcaggccattccactggatcgcaccagagctaatctcaacagcatgctccagacg
ctgtgcgacagacagatcccgactctgtttgccggcatctgcctgctgcgcgatctcggc
ccggaatataatgccggctttcaggcgcttttcgcagaactggccacacaccacaaagtg
gttttttaccccgactacctcgagggagtcgccggccaccccgcgttattgcaaaaagat
caactgcaccccaacctggcgggaacgcagaaaatcgcacgccgccttctgcccctggtc
accgacatgatccgcaagttcgagacggaccaatcagcgcccctgtga

DBGET integrated database retrieval system