KEGG   Pelobacter carbinolicus: Pcar_2754Help
Entry
Pcar_2754         CDS       T00285                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pca  Pelobacter carbinolicus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcar_2754 (folA)
   00670 One carbon pool by folate
    Pcar_2754 (folA)
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pcar_2754 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3211709..3212167)
Genome map
AA seq 152 aa AA seqDB search
MTIVVAMTAERIIGRRGQLPWSIPEDLALFRRLTYGHTLVMGRRTFESIGRPLPGRFNIV
VSRSMPPVEGLRVCRHFAEALQVADQGNGDIFFIGGCEIYRQALIVAGKLSVSWIRKNYP
GDCRFPEYRSDDWLIEQEQDYSEFRHIIYRRR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgtggttgccatgactgccgagcgaattatcgggcgtcgaggacaactcccc
tggagcattcccgaagacctggcattattccgacgattgacctacggtcatacgctggtg
atggggcggcggactttcgagtccataggtcgcccgttgcccggtcgttttaatatcgtg
gtaagccgtagcatgccgccggttgagggtttgagagtctgccgccattttgccgaggcc
ttgcaagtcgccgatcaaggcaatggagatattttttttatcggtggatgcgagatttac
cgtcaggcccttatcgtggccggcaagctctccgtttcctggatcaggaagaattacccc
ggagactgccgtttccccgaatatcggtcggatgactggctgattgagcaagagcaggac
tattccgaattccggcacattatctatcgccgcaggtga

DBGET integrated database retrieval system