KEGG   Pelobacter carbinolicus: Pcar_2758Help
Entry
Pcar_2758         CDS       T00285                                 

Definition
NAD-dependent aldehyde dehydrogenase, CoA-acylating
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pcar_2758
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_2758
   00620 Pyruvate metabolism
    Pcar_2758
   00650 Butanoate metabolism
    Pcar_2758
  Lipid metabolism
   00071 Fatty acid degradation
    Pcar_2758
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pcar_2758
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pcar_2758
   00626 Naphthalene degradation
    Pcar_2758
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pcar_2758
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pcar_2758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3214357..3215706)
Genome map
AA seq 449 aa AA seqDB search
MAKEMIDQLVANARKAADEFREFTQEQVDKITAAMDAASVANEVKLGELAVEETGIGRAD
HKAIKNHLGAHVVYEYFKDKKSVGVIEEKEGVKYIAEPFGVLAAATPTTNPTSTVMFKSL
IAMKTRNVIIFAFHPRAQKCSAEAAKIMLDAAISAGAPKNCIQWIETPSIEATNMLFNHP
DVNLILATGGNAMVKSAYSSGHPAIGVGAGNTPVFVSKSANLSVAVNNVIASKTFDNGTI
CSSDQSMIFDDKDIADKAVKMLVERGAYLVNDEEKAKLEKVMFDKERGVPAVAIVGKSPQ
AIAKLAGFEVPEDAKLLLVPLKCIGPDDWFSHEKLSPVLGYISYNSTDEAIEAAKSQLRW
GGAGHTAVVHAQDEKVLDKFALEIPANRLLLNQPAVHGSVGLIYNKLPPSLTLGCGTDGN
NYLGNNINYSDLLSIKSVAQRIVDYERDE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaatgatcgatcaattggtagccaatgcaagaaaggctgctgacgaattc
agggagtttacccaggagcaggtcgataagatcaccgcggcaatggatgcagccagcgtt
gctaacgaagtcaaacttggtgaattggccgtagaggaaaccggtatcggccgggccgac
cataaagccatcaagaatcatcttggcgcccacgttgtttatgagtatttcaaagataag
aaatccgttggcgttatcgaagaaaaggaaggcgtaaaatatatcgctgagccttttggt
gtgcttgctgccgcaactccgacgaccaaccccacatcgacggttatgttcaagtctctc
atcgccatgaagacgcgtaacgtcatcattttcgctttccacccccgtgctcagaagtgc
agtgccgaagcggccaagatcatgctggacgccgctatttccgcaggcgctcccaaaaac
tgcattcagtggattgaaacgccgtccatcgaagctaccaacatgctgttcaaccacccg
gacgtgaacctgattctggctaccggcggtaacgccatggtcaagtccgcttacagctcg
gggcatcccgccatcggcgtcggtgcagggaatacccccgttttcgtttccaagtccgct
aatctcagcgttgcggttaacaacgtcattgcgtccaagacctttgacaacggcaccatc
tgctcttccgatcagtcgatgatcttcgacgataaggatatcgccgataaggccgtgaag
atgctggttgaaagaggcgcctacctcgtcaacgatgaagagaaggcgaagcttgaaaaa
gtcatgttcgacaaggaaagaggcgttccggccgtagccattgtcggtaagtctccgcag
gccattgccaagcttgccggttttgaagtgcctgaagacgccaagctgctgctcgtgccg
cttaagtgcatcgggcctgacgattggttcagccacgaaaagctctcccccgtacttggt
tacatcagctacaacagtacggacgaggccatcgaggcggcaaaaagccagcttcgttgg
ggtggcgccggtcacaccgccgtcgttcatgcccaggacgaaaaagtcctcgacaagttt
gccctggaaattcctgccaaccgtctgcttttgaatcagcctgcggtacacggcagcgtc
ggtctcatctacaacaaactgccgccttcgctgacccttggttgcggcacggatggcaac
aactatctgggcaacaacatcaactactctgaccttttgagcatcaagtcggtcgcacag
cgtatcgtggactacgaaagagacgagtaa

DBGET integrated database retrieval system