KEGG   Pelobacter carbinolicus: Pcar_3030Help
Entry
Pcar_3030         CDS       T00285                                 

Gene name
fucA
Definition
D-ribulose-1-phosphate/L-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pca  Pelobacter carbinolicus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pca00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3540945..3541607
Genome map
AA seq 220 aa AA seqDB search
MTIDKQREAILKYGRKMLTSQLTTGAGGNLSICDRTSGRVAISPSGIEYFDMKPEDVVIT
DLNGQVLEGKYKPSSELGFHLALYRERQDVNAVVHTHSVYATTMACLGWEIPAVHYLVGF
SGYKVPVAPYATFGTDELAQNVAKGIGAYNAVLLANHGLVAVGSDIGRAFNTAEEIELVA
RIYYQTKAVGEPVILPDQEMERVLAKFATYGQSPKDTDHV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgataaacaacgcgaagccatcctcaaatacggacgcaagatgctcacttcg
cagctgaccaccggcgcgggcggcaacctgagtatctgcgaccgaaccagcggccgtgtt
gccatcagtcccagcggtatcgaatatttcgacatgaagccggaagacgtggtcattacc
gacctgaacggacaggtactcgaaggaaaatataagccttccagcgaactcggtttccat
ctggcgctgtaccgtgagcgacaggatgtaaacgccgtggtccatacccactcggtatat
gccaccaccatggcctgcctcggctgggaaattccggcggtgcactatctggtcggtttc
tccggctacaaggtgccggtggctccctacgccaccttcggcactgacgagctggcccaa
aacgtcgccaaaggcatcggcgcctacaatgccgtcctgctcgccaaccatggtctggtc
gccgtcggcagcgacatcgggcgggcctttaacaccgccgaggagatcgagctggtggcg
cgtatctactaccagaccaaagcggtgggtgagccggtgatcctcccggaccaggagatg
gaacgggtgctggccaaatttgcaacctacggccagtcgccgaaggataccgaccatgtt
tga

DBGET integrated database retrieval system