KEGG   Pelobacter carbinolicus: Pcar_3062Help
Entry
Pcar_3062         CDS       T00285                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III C2,C7-methyltransferase and uroporphyrinogen III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00860  Porphyrin and chlorophyll metabolism
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
Module
pca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcar_3062 (hemD)
Enzymes [BR:pca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Pcar_3062 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pcar_3062 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Adeno_E1B_55K_N
Motif
Other DBs
NCBI-ProteinID: ABA90297
JGI: Pcar3062
UniProt: Q3A010
Position
complement(3578224..3579765)
Genome map
AA seq 513 aa AA seqDB search
MNRCENSATGIVYLVGAGPGDPGLLTVRGLQCLRRAEVVVYDYLANPQLLHEAPATAERI
YVGKTAGHHHLPQEKINALLVEKARLGKVVVRLKGGDPCLFGRGGEEACELAEAGLPFEI
VPGVTAGFGAAIYAGIPLTHRDYTTSLGLITGHEDPKKKVSSLDWSKLATGVGTLLFYMG
MGNLATITKKLVQHGRAPDTPVAVVRWGTTPRQQTLVGTLADITERVQQARLGPPAIIVV
GEIVALRKQLRWFDNRPLFGRRILVTRAAGQAGVLTEGLQAAGAEAICCPTLEIVPPPDW
QELDAALQQLPGTDVLVLTSVNAVNYFFERLFALGHDSRLLHDVCIAAVGPKTAAALRQY
GLRADLLPDEQRAEGVLEVLLDRGVTGKRILYPRSQRARDLLVTELSAAGAEVCAPVAYH
TRAAVGAAEQLREALEQGVDAVTFASSSAVDHCLQALGDDGQRLLAGVTIASLGPLTSDT
VRRHGLEVAVEAAVPTVEMLIEALQGYFGELEA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttgcgaaaacagcgccacaggcatcgtttatctggtcggagccggtcccggc
gatcccggcttgctgaccgtgcggggattgcagtgcctgcgccgtgccgaagtcgtggtc
tacgattacctggccaatccgcagctgctgcatgaggcaccggccacggccgaacgcatc
tatgtcggcaaaacggctggccaccatcacctgcctcaggagaagatcaacgcgctgctg
gtcgaaaaagcgcgtctgggcaaggtggtggtgcgtctcaaggggggtgatccctgtctt
ttcggtcggggcggcgaagaggcctgcgaactggccgaagcgggtttgcctttcgagatc
gtgccgggtgtcaccgccggtttcggcgccgccatctatgccgggattcccttgacccat
cgtgattacaccaccagtctgggtttgatcaccggccatgaagatccgaaaaagaaggtg
tcgagtctcgactggtcgaaactggccaccggggtcggtaccctgctgttttacatgggc
atgggcaatctggccaccatcaccaaaaagcttgtgcaacacggtcgcgcgcccgacact
ccggtggccgtggtacgctggggcaccaccccgcggcagcagaccttggtcggcacgctg
gccgatatcaccgaacgcgtgcagcaggcccgcctgggcccgccggccatcatcgtggtc
ggtgaaatcgtggcactgcgcaagcagttgcgttggttcgacaaccggccgctgttcggg
cggcgcattctggtgacccgggccgccggccaggccggtgtcctgaccgagggcttgcag
gccgccggggccgaggccatctgctgtccgaccctggagatcgtgccgcctcccgactgg
caggagctggatgccgccttgcagcagctgcccggtaccgatgtattggtgctgacctcc
gttaatgcggtaaactatttcttcgaacggttgtttgccctggggcacgacagtcgcctt
cttcatgatgtttgtatcgccgcggtgggccccaaaaccgctgccgctcttcggcagtat
ggcctgcgcgccgatctgctgcccgatgagcaacgcgccgaaggggtgctggaggtgctt
cttgacaggggcgtgaccggcaagcgcattctctacccccgtagccaacgggcccgcgat
ctgttggttacggaactgtccgctgccggtgccgaggtctgtgccccggtggcctatcat
acccgtgccgccgtcggtgctgccgagcagctgcgtgaagccctcgagcagggtgtcgat
gccgtgacctttgcctcgtcctcggcggtggatcattgcctgcaggctcttggcgatgac
ggtcagcggctgctggcaggggtgacgatcgccagcctcggccctctgaccagtgacacc
gtccgccgacacggtctggaggttgccgtggaggctgcggtgccgacggtggagatgctg
attgaggctttgcaggggtattttggcgagctggaggcatag

DBGET integrated database retrieval system