KEGG   Plasmodium chabaudi: PC000014.02.0Help
Entry
PC000014.02.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pcb  Plasmodium chabaudi
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pcb01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pcb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pcb00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:pcb00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 856 aa AA seqDB search
MKKSDTCEINENEHVDDTEFLTYEETNNIKKKAYRDYINYINERRYPYINYLKTKNEKII
KKLLIANNGMAALKCILSLKEWLFKTFNDENLIQIIVLATEDDIRSNSKYISLSDKVIKV
PPGKNSYNYANVSLIVDIAKKENVDAVWPGWGHCSENPLLSSMLEKENIIFIGPTDNVME
ALGDKISANILAQSVNVPVVKWSGDNLKIDDFENNSINQDIYNKSTIHSLEECISECKRI
GYPVMIKASQGGGGKGIRKVENENEIKKYYEQVQNELPNSPIFLMKVCSNVRHIEIQVVG
DMYGNVCSLSGRDCTTQRRFQKIFEEGPPSIVPPHIFREMEKASIRLTKMIKYRGAGTIE
YLYDQINNKYYFLELNTRLQVEHPVSEGITDTNIVAIQLQVAMGIPLQNIDDIKKLYKIE
EKTKKNASLSSVSSSSDNLKLSISEKDNNSVVKNNLSEKLGMFDFYNNMPHTKNHVIAAR
ITAENSNDSFKPTSGLVKNVNFQNSKDVWGYFSINNGFVHEFSDSQIGHIFAKGETREMA
RKNLILALRKLNIDGEIKTVTKYLAKILESKAFIDNNITTNWLDVVIERKKNIYYNTFHI
IILCAAIFKLLIYFMKEMENMEDSLNREDIAIKSENSINDISLKGKMKRAYIFDIIFQNV
KYMFKGYNTGEDLYKLNINDQEIEILAKYDKENNKIFASFHNQTYIYTCIEDSLGTHMNL
GKDNVFIPVITNPYHLISNTNGKIVKYLIKDGEKINKFDDYIEVEAMKMIMTFKSTETGI
LKHKMSEGAMIKIGDLLGVIEKEKDNHNSPNDDNNNKIIDFVGHLNLSNKNAYELDGTFF
PDLAEESHNNEMFCDN
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtgatacttgtgaaataaatgaaaatgagcatgttgatgataccgaattt
ttaacatatgaagaaacaaataacataaaaaaaaaagcatatagagattatatcaattat
ataaatgaaagacgatatccatatataaattatttaaaaactaaaaatgaaaaaataata
aaaaaattgttaattgctaataatggtatggcagcattaaaatgcatattgtcattaaaa
gaatggttatttaaaacatttaatgatgaaaatttaatacaaataattgtattagctact
gaagatgatataagaagtaattccaaatacatatctttatcagataaagttattaaagtt
cctcctggaaaaaacagttataattatgcaaatgtttctttaattgttgacattgcaaaa
aaagaaaatgtcgacgcagtttggccaggttgggggcattgctcggaaaatccattattg
tcatccatgttagaaaaggaaaatataatttttattggaccaactgataatgttatggaa
gcattaggtgataaaatatcagccaacattttagctcaaagtgttaatgtgcctgttgtt
aaatggagtggcgataatttaaaaattgatgattttgaaaataattcaattaatcaagat
atatataataaatctactattcattcgttagaagaatgcatcagtgaatgcaaaaggatt
ggttatcctgttatgataaaagcgtcgcaaggtggtggtgggaaaggtattcgaaaggta
gaaaatgaaaatgaaattaaaaaatattatgaacaagttcaaaatgaattaccaaattca
ccaatatttttaatgaaagtatgcagcaatgttagacacattgaaatacaagttgttggt
gatatgtatggaaatgtttgctcattaagtggtagagattgtactacacaaagacgattt
caaaaaatatttgaagaggggccaccttctattgttcctccacatatttttagagaaatg
gaaaaagcatctatacgtttaacaaaaatgatcaaatatagaggtgcgggaaccattgaa
tatttatatgatcaaattaataacaaatattactttttagaattaaatacacgtttacaa
gtagagcatcctgtttcagaaggaataactgataccaatattgttgctattcagcttcaa
gttgctatgggcatacctcttcaaaatatagacgatataaaaaagttatataaaatagaa
gagaaaacaaaaaaaaacgcatcattaagcagtgttagtagttcaagtgataatttaaaa
ctttcaataagtgaaaaagataataatagtgtagtgaaaaataatttgagtgaaaaattg
ggtatgtttgatttttacaacaacatgccccatactaaaaatcatgtaattgctgctcga
ataacagccgaaaacagtaatgatagttttaaaccaacatccggattagtaaaaaatgtt
aattttcaaaattcgaaagatgtatggggatatttttctattaacaatgggtttgttcat
gagttttcagattcacaaattggtcacatatttgcaaaaggagaaacaagagaaatggct
agaaagaatttaattctagcactaaggaaattaaacatagacggagaaattaaaacagtt
acaaaatatttagcaaaaatattagaatccaaagcatttatagataacaatataacaaca
aattggctagatgttgtaatagaacgaaaaaaaaatatttattacaatacttttcatata
attattttgtgtgctgccatatttaaattgttgatttattttatgaaagaaatggaaaat
atggaagatagtctaaatagggaagatattgcaataaaatcagaaaatagtatcaatgac
ataagtttaaagggaaaaatgaaaagagcatatatttttgatataatttttcaaaatgta
aagtatatgttcaaaggatataatactggtgaagatttatataaactgaatataaatgat
caagaaatagaaatattagcaaaatatgataaagaaaataataaaatatttgcatcattc
cataatcaaacatatatatatacatgtatagaagattccttaggaacacatatgaattta
gggaaagacaatgtatttatccctgttattacaaatccatatcatttaatatcaaataca
aatggaaaaattgtaaaatatttaataaaagatggtgaaaaaattaataaatttgatgat
tacatagaagtagaagcaatgaaaatgattatgacttttaaatctactgaaactggtata
ttaaagcataaaatgtcagaaggtgctatgataaaaattggtgatttattaggagttata
gaaaaggaaaaagataatcataattctccaaatgatgataataataacaaaattattgat
tttgttggccatctaaatttgtcaaacaaaaatgcatatgaattagacggaacatttttt
ccagatttagcagaagagtcgcataataacgaaatgttctgtgacaac

DBGET integrated database retrieval system