KEGG   Plasmodium chabaudi: PC000036.02.0Help
Entry
PC000036.02.0     CDS       T01108                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase, faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PC000036.02.0
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PC000036.02.0
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PC000036.02.0
Lipid biosynthesis proteins [BR:pcb01004]
 Desaturase
  First
   PC000036.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 800 aa AA seqDB search
MLDENYWDIKYVGIIYISYIVGLASCYFLRKICSQSFVNFIKVLKGVLVSIISVMSLKYL
NINTRVGINLLHIYNIVQVCSFLEVFSIRTKHPNKKLSSEQTPIVNKYELDNENADQHTL
IGDASQHLEKIAKTILNDKKSLEKNKGILKEKELIEQIEQEEKKEEEYMKAKNNSNSQKR
NNRNKINLVWIYVLLSKTFNVMFFSLFWKLIPNLTIVKIFLTLQLCTSLIYTANTVYKNN
SNIKLLKKLSDGLNIVYYIFISLFFTKILYTFDDNYNNSIIQNFAVVSIVFHMYYGYMAF
VKYIYDYYKQFRPSLFSFILFFHVFSIIGIIKLYHHEHRKSLLIQCIAFYLINGFGITFG
AHRLWSHRAFKASTFVQVLFLILNSFANQGSVIIWAKNHRLHHKYSDTKYDPHNIRNGFF
YSHVGWLLYQKTKFVKEKEKEIYVDDLLQNPILMLQHKLDPYFNFFFCFIIPGIYTYYMY
NNFWDGFLILGALRWIITLHATWSINSASHSFGHRPYNDDIKASNNIFTSIVALGEGCHN
YHHVFPYCYAMNENFYILSINPTKYVIQLFYYLGLVWDLKSAQNICKEVRLRESLKIEQR
NKRLSENIKNQILKKEDTGYITDLMNSFKAFCNDYINISTFMYILYFLRDITIMLTIFLI
HIWYCYNKYGNGTAFSNLSLENNKLLNIVLFTLFHIILYALPMGTMFISLYSLVYECKRG
LIFKNQFLNNLFGSIISSFILLPYSSEKSRKSLLTSLNEDFFKVLKGPIYFDLYTIIFSL
VSVLYGFIAYGFGHFYFCTF
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgaaaattattgggatattaaatatgtaggaataatatatatatcgtatatt
gttggtttggcttcttgctattttttgagaaaaatttgttctcaatcttttgttaatttt
ataaaagttttaaaaggtgttttagtttcaataatttctgtgatgagcttgaaatattta
aacataaataccagggtaggcattaatttacttcacatatataatattgtgcaagtgtgt
agctttttagaagtatttagcataagaactaaacacccaaataaaaagttgtcaagcgag
caaacaccaatcgttaataaatatgagttagataatgaaaatgcagatcaacacacatta
ataggggatgcgtcacaacatttagaaaaaatagcaaagactattttgaatgacaaaaaa
tccttagagaaaaataaaggaatattaaaagaaaaggaacttatagaacaaattgaacaa
gaagaaaaaaaagaagaagaatatatgaaagcaaaaaataatagtaattcccaaaaaaga
aataatagaaataaaataaatttggtttggatttatgttttactttcaaaaacatttaat
gtaatgtttttttctttattttggaagttaatacccaatttgacaatagtaaaaatattt
ttgaccttacagttatgtacaagcttgatttatactgctaatacagtttacaaaaacaat
tcaaatataaaattattgaaaaaattatcagatgggcttaatattgtatattatattttt
ataagtttattttttacaaagatattgtatacatttgatgacaattataataatagtata
atacaaaatttcgcagtcgtttctattgtctttcatatgtattatggatatatggcattt
gttaaatatatttatgattattataagcaattcagaccatcattattctcatttatatta
ttttttcatgtattttccataatcggaataataaaattatatcaccatgaacaccgaaaa
tccttgttaatacagtgcatagcattttacctcattaatggatttgggataacatttggt
gcccatcgattgtggtcacatagagcatttaaagctagtacattcgtacaagttttattt
ctaattttgaatagttttgcaaatcaaggtagtgtaatcatatgggcaaagaatcatcgt
ttacatcataaatatagtgatacaaaatatgatcctcataatataagaaatggttttttt
tatagtcatgttggatggttattatatcagaaaacaaaatttgtaaaggaaaaagaaaag
gaaatttatgttgacgatctattacaaaatccaattcttatgttacaacataaattagat
ccatatttcaacttttttttttgtttcataataccaggtatatatacctactatatgtat
aacaatttttgggatggatttttaattttaggggctcttagatggattattacgttgcat
gccacatggtcaattaatagtgcttctcattcatttggacatagaccatataatgatgat
ataaaagcttctaacaatatctttacatcaatagtagctcttggagagggatgtcataat
tatcatcatgtatttccatattgttatgctatgaatgaaaatttttatattcttagtata
aaccccacaaaatatgtaatacagcttttttattatttgggattagtatgggatttgaaa
tcagcacaaaatatatgtaaagaagtccgattaagagaatcattaaaaatagagcaaaga
aataaaagattaagtgaaaacattaaaaatcaaatattgaaaaaagaagacacaggttat
ataacagatttaatgaattcctttaaagcattttgtaacgattatataaatatttctaca
tttatgtatatattatactttttaagagatattactattatgcttactattttcctaatc
cacatatggtattgttataataaatatggaaatggaacagccttttcaaatttatcatta
gaaaataataaactgttaaatattgttttgtttacactatttcatataattctatatgcc
ttacccatgggaacgatgtttataagtctctattcactagtttatgaatgcaaaagagga
ttaatctttaaaaatcagttccttaacaacttatttggtagcataatatcatcttttatt
ttattaccatattcctctgaaaaatcaagaaaatccttattaacatcactaaatgaagat
ttctttaaagttttaaaagggccaatatactttgatttatatacaattattttttcttta
gtatcagtattatatggatttattgcttacggatttgggcacttttatttttgcaccttt

DBGET integrated database retrieval system