KEGG   Plasmodium chabaudi: PC000127.01.0Help
Entry
PC000127.01.0     CDS       T01108                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PC000127.01.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PC000127.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
NQLFEVGLKETSANQNSSIRKHILFRIYGKDVGELYNTDLEVEVYETMSKYKISPKLLNV
FSGGRIEEWLYGNPLKNEDLQNSKILIAIANMLGKFHTLAIKKKLPTHWDKTPCIYKRIN
EWKIQLSKMKNLDKFKGDINKYYQESDKFMKFMNTYTQTDSINNHITFCHNDLQENNIIN
TNNCLRLIDFEYAGYNYTATDIAIFFIETAIDYSTDTYPFYEINKSKYLSYEKRKMFINE
YLS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
aatcaattatttgaagtaggattaaaagaaacttcggctaatcaaaattcatcaataaga
aaacacattttatttagaatatatggaaaagatgttggtgaattatataatacagactta
gaggttgaagtatatgaaacgatgagtaaatataaaatatctccaaaattattaaacgta
ttttccggtggccgtatagaagaatggctatatgggaatcctttaaaaaatgaggattta
caaaactcaaaaatattaattgctatagctaatatgctaggtaaatttcatacattagct
attaaaaaaaaattaccaacccattgggataaaacaccatgcatttacaaaagaataaat
gaatggaaaatacaactttctaaaatgaaaaacttagataaatttaaaggtgatataaat
aaatattatcaagaatctgataaatttatgaaatttatgaatacatatacacaaacagat
agtattaataatcatataactttttgtcataacgatttacaagaaaataatattataaat
acaaacaattgtttacgactaattgattttgaatatgctggatataattatacagctaca
gatatagcaatattttttattgaaacagctattgattattctacagacacttatcctttt
tatgaaataaataaaagtaaatatttatcatatgaaaagagaaagatgtttattaatgaa
tatttatca

DBGET integrated database retrieval system