KEGG   Plasmodium chabaudi: PC000127.01.0Help
Entry
PC000127.01.0     CDS       T01108                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pcb00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
NQLFEVGLKETSANQNSSIRKHILFRIYGKDVGELYNTDLEVEVYETMSKYKISPKLLNV
FSGGRIEEWLYGNPLKNEDLQNSKILIAIANMLGKFHTLAIKKKLPTHWDKTPCIYKRIN
EWKIQLSKMKNLDKFKGDINKYYQESDKFMKFMNTYTQTDSINNHITFCHNDLQENNIIN
TNNCLRLIDFEYAGYNYTATDIAIFFIETAIDYSTDTYPFYEINKSKYLSYEKRKMFINE
YLS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
aatcaattatttgaagtaggattaaaagaaacttcggctaatcaaaattcatcaataaga
aaacacattttatttagaatatatggaaaagatgttggtgaattatataatacagactta
gaggttgaagtatatgaaacgatgagtaaatataaaatatctccaaaattattaaacgta
ttttccggtggccgtatagaagaatggctatatgggaatcctttaaaaaatgaggattta
caaaactcaaaaatattaattgctatagctaatatgctaggtaaatttcatacattagct
attaaaaaaaaattaccaacccattgggataaaacaccatgcatttacaaaagaataaat
gaatggaaaatacaactttctaaaatgaaaaacttagataaatttaaaggtgatataaat
aaatattatcaagaatctgataaatttatgaaatttatgaatacatatacacaaacagat
agtattaataatcatataactttttgtcataacgatttacaagaaaataatattataaat
acaaacaattgtttacgactaattgattttgaatatgctggatataattatacagctaca
gatatagcaatattttttattgaaacagctattgattattctacagacacttatcctttt
tatgaaataaataaaagtaaatatttatcatatgaaaagagaaagatgtttattaatgaa
tatttatca

DBGET integrated database retrieval system