KEGG   Plasmodium chabaudi: PC000139.04.0Help
Entry
PC000139.04.0     CDS       T01108                                 

Definition
mitogen-activated protein kinase 1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PC000139.04.0
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PC000139.04.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MEKEKQKKAQKNVSKLLHTKSNKNETDNIDDHVLKKYDIIKKIGKGAYGIVFKARCRKSK
KIVAVKKIFGAFQNSTDAQRTFREIMFLHQLNGHDNIIKLLDVMRAKNDQDIYLVFEYME
TDLHEVIRADILEEIHKKYIIYQLLRALKYMHSGLLLHRDIKPSNILLNSECHLKICDFG
LARSISTEVNENKIPVLTDYVATRWYRAPDILLGSTNYTEGVDMWSLGCIMAELLLGKPL
FRGNSTMNQLEKIIEIVGKPNKKDIEDIKSPYAETIISSFADTGKKKKFSEIFHKA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagaaacagaagaaagctcaaaaaaatgtgtctaaactgttacataccaaa
tcaaataaaaatgaaacagataatattgatgatcatgttttaaaaaaatatgatataata
aaaaaaattggaaagggagcatatggtatagtattcaaagcacggtgtagaaaatctaaa
aaaatagtagcagtaaaaaaaatttttggggcatttcaaaattctacagatgctcaaaga
acatttagagaaataatgtttttacatcaactaaatggacatgataatataattaaatta
ttggatgtaatgagagcaaaaaatgatcaagacatttatttagtttttgaatatatggaa
acagatttacatgaagttataagagcagatatattagaagaaattcataaaaaatatata
atatatcaattattaagagcattaaaatatatgcattcaggtttattattacatagagat
attaaaccatcaaatatattattaaattcggaatgccatttaaaaatatgtgattttgga
ttagctcgaagtatatcaacagaagttaatgaaaacaaaataccagttttaacagactat
gtagcaacacgatggtatagagcacctgatattttattaggaagtacaaattatacagaa
ggtgtcgacatgtggtcgcttgggtgcattatggctgaattattattaggaaaaccatta
tttagaggtaattcaactatgaaccaattagaaaaaattattgaaatagttggaaaacca
aataaaaaagatattgaagatataaaatcaccatatgctgaaactattatatcttctttt
gctgatactggaaaaaaaaaaaaattttcagaaatttttcataaagca

DBGET integrated database retrieval system