KEGG   Plasmodium chabaudi: PCHAS_101410Help
Entry
PCHAS_101410      CDS       T01108                                 

Gene name
PC000139.04.0
Definition
(RefSeq) mitogen-activated protein kinase 1, putative (EC:2.7.11.24)
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PCHAS_101410 (PC000139.04.0)
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PCHAS_101410 (PC000139.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 599 aa AA seqDB search
MEKEKQKKAQKNVSKLLHTKSNKNETDNIDDHVLKKYDIIKKIGKGAYGIVFKARCRKSK
KIVAVKKIFGAFQNSTDAQRTFREIMFLHQLNGHDNIIKLLDVMRAKNDQDIYLVFEYME
TDLHEVIRADILEEIHKKYIIYQLLRALKYMHSGLLLHRDIKPSNILLNSECHLKICDFG
LARSISTEVNENKIPVLTDYVATRWYRAPDILLGSTNYTEGVDMWSLGCIMAELLLGKPL
FRGNSTMNQLEKIIEIVGKPNKKDIEDIKSPYAETIISSFADTGKKKKFSEIFHKASQDS
IDLLEQLLQFNPTKRITAEKALKHKYVENFHHLIEEPVCKHIITIPVDDSTKYRVDFYRN
IVYYNILKRKKMSIHREHYTNAQISNSKNESIKENMLESQISNDVKTDVQIDAEQAEYII
QKGDNYDIHKMDSKKGRGKKKRHFISNSPNTNIETHQKGEPNCRENNLHYPVEKKADVDG
PQGNKEKGSNTKKKLKNKIKSKPKVVSTKNAGKKDPLYCDRSEALHNKSYVQGKNEKHYY
EHTGENNDNINEMADQNNYYKTVVNPNIEGQCRNTMPIHNYNTGQDFSKHYFYKQKKKY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagaaacagaagaaagctcaaaaaaatgtgtctaaactgttacataccaaa
tcaaataaaaatgaaacagataatattgatgatcatgttttaaaaaaatatgatataata
aaaaaaattggaaagggagcatatggtatagtattcaaagcacggtgtagaaaatctaaa
aaaatagtagcagtaaaaaaaatttttggggcatttcaaaattctacagatgctcaaaga
acatttagagaaataatgtttttacatcaactaaatggacatgataatataattaaatta
ttggatgtaatgagagcaaaaaatgatcaagacatttatttagtttttgaatatatggaa
acagatttacatgaagttataagagcagatatattagaagaaattcataaaaaatatata
atatatcaattattaagagcattaaaatatatgcattcaggtttattattacatagagat
attaaaccatcaaatatattattaaattcggaatgccatttaaaaatatgtgattttgga
ttagctcgaagtatatcaacagaagttaatgaaaacaaaataccagttttaacagactat
gtagcaacacgatggtatagagcacctgatattttattaggaagtacaaattatacagaa
ggtgtcgacatgtggtcgcttgggtgcattatggctgaattattattaggaaaaccatta
tttagaggtaattcaactatgaaccaattagaaaaaattattgaaatagttggaaaacca
aataaaaaagatattgaagatataaaatcaccatatgctgaaactattatatcttctttt
gctgatactggaaaaaaaaaaaaattttcagaaatttttcataaagcatcccaagactca
atcgatctacttgagcaactgctacaatttaatccaacaaaaagaataacagcagaaaaa
gctttaaaacataaatatgtagaaaattttcaccatttaatagaggaaccagtttgcaaa
catattattactatacctgttgatgatagtacaaaatatagagttgacttttatcgaaat
attgtatattataatattttaaaaagaaaaaaaatgtctattcatagagagcattataca
aatgctcaaattagtaattcaaaaaatgaatcaataaaagaaaatatgttagaatcacaa
ataagtaatgatgtaaaaacagatgtacaaatagatgccgaacaagctgaatatataatt
cagaagggagacaactatgatatacataaaatggattcaaaaaaaggtagaggaaaaaaa
aaacggcattttatatctaattcaccaaatacaaacatagagacacatcaaaagggtgag
ccaaattgtagagaaaacaatttacactatcctgtggaaaagaaagcagatgtggatgga
cctcaagggaataaagaaaagggaagcaataccaaaaaaaagttgaaaaataaaataaaa
tcgaagccaaaagtggtgagcacaaaaaatgctggaaaaaaagatccactatactgtgat
agatcagaagctttgcacaacaaaagttatgtacaaggcaagaatgaaaagcactactat
gaacatacaggtgaaaataatgataatataaatgaaatggccgaccaaaataactactat
aaaactgtagtcaatccgaatattgaaggccagtgtcgaaatacaatgcccatacataat
tataacactggacaagattttagtaaacattatttttataaacaaaagaaaaagtattga

DBGET integrated database retrieval system