KEGG   Plasmodium chabaudi: PC000141.00.0Help
Entry
PC000141.00.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pcb  Plasmodium chabaudi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 559 aa AA seqDB search
KMKGEINNIENAQESKYEDMDREYYNCIKNCAADLQNLSLNFFPSINAYACIPKLNAINS
ITFHPCISTKDYYNNTYSFKPLFTHHFFSDSEQVIGFESLKIDFYYTCDSYEVYMKLSGS
ITDQYENSNYIMLSLLQSLYITTPYPGGFVESEEDFLKILRKNEIRQEKNKHKKSRSIKD
KHYKNIVNRNNYIPPGFVIYEKKLNEKIYLQIRKCGFSQTYFKSKNKNNNKLDGSEIIRN
SFCNNNDILLQASNNVNNMTLDHSTTLDKSESNQIHDTMNKVSNNDSTSNSTCKTSSNNS
NTCLSNSSLSIENEKIDGDEKESGKQDGHIELNNKGDEDTINREIDIDNKKGKKKFTKYV
TEKDLSKLYREYLNIIKDKKRRDSTIKEMKEKSNSLEKLNESEMGLNGNIETVEKSEESK
ESIIENKIMKTKDEGKDEKGNDKIIEKTDEEKKKRRGTSEDKYNKYDYTIKSNFELLHRK
VEWFYHWFIESASNIEYDCRWNVILPYIVFKQENTKSFNENDFIDSLNVHLNRERGIVDN
KTGENNLVENSNEQKVKGG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
aaaatgaaaggggaaataaataatatagaaaatgctcaagaaagcaaatatgaagatatg
gatagggagtactataactgtataaagaattgtgcagcagatttacaaaatttatcatta
aatttttttccatccattaatgcatatgcatgtattcccaaactgaatgctataaattcg
attacatttcatccatgtatttctactaaggattattataataatacctattctttcaag
cctttatttactcaccatttttttagcgacagcgaacaggttatcggattcgagtcgtta
aagatcgatttttactacacgtgtgacagttatgaagtgtatatgaagttaagtggctca
ataacggaccagtatgaaaattcgaattatattatgttatcgcttttacaaagtttgtat
atcactactccgtatccaggtgggtttgttgaatcggaagaagattttttaaaaatttta
agaaaaaatgaaataaggcaggagaaaaataaacataaaaaatcaagaagtataaaagat
aaacattataaaaatattgtaaatagaaataattatattcctcctggttttgtaatatat
gaaaagaaacttaatgaaaaaatatatttgcaaatacgaaaatgtggattttctcaaaca
tattttaaatcaaaaaataaaaataataataagttggatggatctgagattataagaaat
tctttttgtaataataatgatattttacttcaagcaagtaataatgtaaataatatgact
cttgatcattcgactacgttagataaatcagagtcaaatcaaattcatgacactatgaat
aaagtatcaaacaacgacagtacttctaatagtacttgtaaaacatctagtaacaatagt
aacacatgtttgagcaatagtagtttatctattgaaaatgaaaagatagatggtgacgaa
aaagagagtggtaaacaagatggacatatagagttaaataataaaggggatgaggataca
atcaatcgagaaatcgatattgataataagaaagggaaaaagaaatttacaaaatatgtt
actgaaaaggatttatcaaaattgtatagagaatatctaaacataataaaggacaagaaa
aggagagatagcactataaaagaaatgaaagaaaaatcaaacagtcttgaaaagttaaat
gaatctgaaatgggattaaatggaaatatagaaactgttgaaaagtcagaagaaagtaaa
gaatcaattatagaaaataaaatcatgaaaacaaaagatgaaggtaaagatgaaaaaggt
aatgacaaaataattgaaaagacagatgaagaaaaaaaaaaaagacgaggaacatcagaa
gataaatataataaatatgattatacaataaaatcaaattttgaattattacatcgaaaa
gtagaatggttttatcattggtttattgaaagtgcttctaatattgaatatgattgtcgt
tggaatgttattcttccatatatagtatttaaacaagagaatacgaaaagctttaatgaa
aacgattttatagactctctaaatgttcatttgaatcgagagagagggattgttgataac
aaaactggcgagaacaatctcgtcgaaaatagtaacgaacaaaaagtaaaaggtggc

DBGET integrated database retrieval system