KEGG   Plasmodium chabaudi: PC000141.04.0Help
Entry
PC000141.04.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PC000141.04.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
KKGRRRSSSNNNSDSGQGSSKGDTNEDDSEYLYYYYLFGLATTYTFFTFQFDRNRISQFL
IFPPMQNKGLGMKVLEKIYHLSIVNSNIKEITVEDPAASFTHLRDIITIKICIDLKILSP
TILYPDDYLKEKNIEKEHPELDKKKFIKVCKETHKQITRMVETISLAGVLPHPAPLYIEN
EDKYIHLRKKEKKNENVNLGNSMESFEASDACKDVRIQIKKRIKSDYIGNLINKNTNCMS
SDVFRDYVKEELNKLWKKQCKVYYR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
aaaaaaggaagaagacgaagtagtagcaacaataatagtgatagtggacaaggtagtagt
aaaggagatacaaatgaagatgattcagaatatttatattattattatttatttggatta
gcaacaacttatacattttttacttttcaatttgatcgaaatcgaatatctcaatttttg
atttttccacctatgcaaaataaaggattaggaatgaaagtgctagaaaaaatatatcat
ctatccattgtcaattcgaacataaaagaaataaccgttgaagatccagcagcttctttt
acacatttaagagatattataactattaaaatttgtattgacttgaaaatactaagtcca
actatattatatcctgatgattatttaaaggaaaaaaacattgaaaaagaacatcccgag
ttagataaaaaaaaatttataaaagtttgtaaagaaactcataaacagattacacgaatg
gttgagaccatatccttagcaggtgttttacctcaccctgctcctttgtatattgaaaac
gaagataaatatattcatcttcgtaaaaaagaaaaaaaaaatgaaaatgtgaatttagga
aactcaatggaaagtttcgaagcttccgatgcatgcaaagatgttagaatacaaattaaa
aagcgtatcaaaagtgattatatcggaaatttgataaacaaaaacacgaactgcatgtct
agcgacgtcttccgagattacgtgaaggaggagctgaacaagctgtggaagaagcagtgc
aaagtctactacaggtaa

DBGET integrated database retrieval system