KEGG   Plasmodium chabaudi: PCHAS_072750Help
Entry
PCHAS_072750      CDS       T01108                                 

Gene name
PC000141.04.0
Definition
(RefSeq) histone acetyltransferase, putative
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PCHAS_072750 (PC000141.04.0)
Chromosome [BR:pcb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PCHAS_072750 (PC000141.04.0)
   HAT complexes
    HATB complex
     PCHAS_072750 (PC000141.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 978 aa AA seqDB search
MKGEINNIENAQESKYEDMDREYYNCIKNCAADLQNLSLNFFPSINAYACIPKLNAINSI
TFHPCISTKDYYNNTYSFKPLFTHHFFSDSEQVIGFESLKIDFYYTCDSYEVYMKLSGSI
TDQYENSNYIMLSLLQSLYITTPYPGGFVESEEDFLKILRKNEIRQEKNKHKKSRSIKDK
HYKNIVNRNNYIPPGFVIYEKKLNEKIYLQIRKCGFSQTYFKSKNKNNNKLDGSEIIRNS
FCNNNDILLQASNNVNNMTLDHSTTLDKSESNQIHDTMNKVSNNDSTSNSTCKTSSNNSN
TCLSNSSLSIENEKIDGDEKESGKQDGHIELNNKGDEDTINREIDIDNKKGKKKFTKYVT
EKDLSKLYREYLNIIKDKKRRDSTIKEMKEKSNSLEKLNESEMGLNGNIETVEKSEESKE
SIIENKIMKTKDEGKDEKGNDKIIEKTDEEKKKRRGTSEDKYNKYDYTIKSNFELLHRKV
EWFYHWFIESASNIEYDCRWNVILPYIVFKQENTKSFNENDFIDSLNVHLNRERGIVDNK
TGENNLVENSNEQKVKGGGKRPFDEVSSNDRKSGSRSKRAKKGEDETDEIEQIKIGEHKD
EIQSHGSNNYELEAKEYVLTRETVMQVIDDTLNNRYEKEEESYYSFHKKYDVVYLCSDLK
NDENYEDEKIVKCEEEGSESLMNIADVKKNGKKKILIEHTKNKKGRRRSSSNNNSDSGQG
SSKGDTNEDDSEYLYYYYLFGLATTYTFFTFQFDRNRISQFLIFPPMQNKGLGMKVLEKI
YHLSIVNSNIKEITVEDPAASFTHLRDIITIKICIDLKILSPTILYPDDYLKEKNIEKEH
PELDKKKFIKVCKETHKQITRMVETISLAGVLPHPAPLYIENEDKYIHLRKKEKKNENVN
LGNSMESFEASDACKDVRIQIKKRIKSDYIGNLINKNTNCMSSDVFRDYVKEELNKLWKK
QCKVYYRTIKKLRSLYPL
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggaaataaataatatagaaaatgctcaagaaagcaaatatgaagatatggat
agggagtactataactgtataaagaattgtgcagcagatttacaaaatttatcattaaat
ttttttccatccattaatgcatatgcatgtattcccaaactgaatgctataaattcgatt
acatttcatccatgtatttctactaaggattattataataatacctattctttcaagcct
ttatttactcaccatttttttagcgacagcgaacaggttatcggattcgagtcgttaaag
atcgatttttactacacgtgtgacagttatgaagtgtatatgaagttaagtggctcaata
acggaccagtatgaaaattcgaattatattatgttatcgcttttacaaagtttgtatatc
actactccgtatccaggtgggtttgttgaatcggaagaagattttttaaaaattttaaga
aaaaatgaaataaggcaggagaaaaataaacataaaaaatcaagaagtataaaagataaa
cattataaaaatattgtaaatagaaataattatattcctcctggttttgtaatatatgaa
aagaaacttaatgaaaaaatatatttgcaaatacgaaaatgtggattttctcaaacatat
tttaaatcaaaaaataaaaataataataagttggatggatctgagattataagaaattct
ttttgtaataataatgatattttacttcaagcaagtaataatgtaaataatatgactctt
gatcattcgactacgttagataaatcagagtcaaatcaaattcatgacactatgaataaa
gtatcaaacaacgacagtacttctaatagtacttgtaaaacatctagtaacaatagtaac
acatgtttgagcaatagtagtttatctattgaaaatgaaaagatagatggtgacgaaaaa
gagagtggtaaacaagatggacatatagagttaaataataaaggggatgaggatacaatc
aatcgagaaatcgatattgataataagaaagggaaaaagaaatttacaaaatatgttact
gaaaaggatttatcaaaattgtatagagaatatctaaacataataaaggacaagaaaagg
agagatagcactataaaagaaatgaaagaaaaatcaaacagtcttgaaaagttaaatgaa
tctgaaatgggattaaatggaaatatagaaactgttgaaaagtcagaagaaagtaaagaa
tcaattatagaaaataaaatcatgaaaacaaaagatgaaggtaaagatgaaaaaggtaat
gacaaaataattgaaaagacagatgaagaaaaaaaaaaaagacgaggaacatcagaagat
aaatataataaatatgattatacaataaaatcaaattttgaattattacatcgaaaagta
gaatggttttatcattggtttattgaaagtgcttctaatattgaatatgattgtcgttgg
aatgttattcttccatatatagtatttaaacaagagaatacgaaaagctttaatgaaaac
gattttatagactctctaaatgttcatttgaatcgagagagagggattgttgataacaaa
actggcgagaacaatctcgtcgaaaatagtaacgaacaaaaagtaaaaggtggcggaaaa
cgaccgtttgatgaggtaagctctaatgacagaaagagcgggtctagaagtaagcgagcc
aaaaagggtgaagatgagacagatgaaattgagcaaattaaaattggtgaacataaggat
gagattcagagtcacggttctaataattatgaattagaagcaaaggaatatgtacttaca
cgtgaaactgttatgcaagttattgatgatacgttaaataatagatatgaaaaagaagaa
gaaagctattattcgtttcataaaaaatatgatgttgtttatttatgttccgatttaaag
aatgatgaaaattatgaggatgaaaaaattgtaaaatgtgaagaagaaggttctgaatct
ttaatgaacatagctgatgtaaaaaagaatggaaaaaaaaaaatattaatagaacataca
aaaaataaaaaaggaagaagacgaagtagtagcaacaataatagtgatagtggacaaggt
agtagtaaaggagatacaaatgaagatgattcagaatatttatattattattatttattt
ggattagcaacaacttatacattttttacttttcaatttgatcgaaatcgaatatctcaa
tttttgatttttccacctatgcaaaataaaggattaggaatgaaagtgctagaaaaaata
tatcatctatccattgtcaattcgaacataaaagaaataaccgttgaagatccagcagct
tcttttacacatttaagagatattataactattaaaatttgtattgacttgaaaatacta
agtccaactatattatatcctgatgattatttaaaggaaaaaaacattgaaaaagaacat
cccgagttagataaaaaaaaatttataaaagtttgtaaagaaactcataaacagattaca
cgaatggttgagaccatatccttagcaggtgttttacctcaccctgctcctttgtatatt
gaaaacgaagataaatatattcatcttcgtaaaaaagaaaaaaaaaatgaaaatgtgaat
ttaggaaactcaatggaaagtttcgaagcttccgatgcatgcaaagatgttagaatacaa
attaaaaagcgtatcaaaagtgattatatcggaaatttgataaacaaaaacacgaactgc
atgtctagcgacgtcttccgagattacgtgaaggaggagctgaacaagctgtggaagaag
cagtgcaaagtctactacaggacgataaaaaaattgaggtcactatacccactttaa

DBGET integrated database retrieval system