KEGG   Plasmodium chabaudi: PCHAS_103880Help
Entry
PCHAS_103880      CDS       T01108                                 

Gene name
PC000171.05.0
Definition
(RefSeq) cytochrome c, putative
  KO
K08738  
cytochrome c
Organism
pcb  Plasmodium chabaudi
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PCHAS_103880 (PC000171.05.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 116 aa AA seqDB search
MSQRPEPQVDVPPGDYKKGAKIFKAKCAQCHTMNKGGAVKQGPNLYGFYGRKSGESDFPY
SDANKNSGIVWSDKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaagaccagaacctcaagttgatgtccctcctggtgattataaaaagggagca
aaaatttttaaggcaaaatgtgcccaatgccacacaatgaataagggtggagctgttaaa
caagggccaaatttatatggattttatggtagaaaatcaggagaatcggattttccatat
tccgatgcaaataagaattctggtatagtatggtctgataagcatttatatgaatattta
cttaaccccaaattatacattccaggaacgaaaatgatttttgctggtataaaaaaagaa
aaagaaagagcagatttgattgaatatctcaaaaaggcttcttcagaataa

DBGET integrated database retrieval system