KEGG   Plasmodium chabaudi: PCHAS_101300Help
Entry
PCHAS_101300      CDS       T01108                                 

Gene name
PC000179.00.0
Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PCHAS_101300 (PC000179.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 224 aa AA seqDB search
MYAIVENNHRDLINNLKRRGIIDDDDVYDTMLQVDRGRYIKENPYIDTPIYISHGVTISS
PHMHALSLKRLMNVLKPGSRAIDVGSGSGYLTVCMAIRVNVLENKNSFVIGIERVKDLVD
FSIENIKRDKPELLNIENFKIIHKNIYQVSEEEQKELGLFDAIHVGASASELPDVLINLL
AENGKLIIPLEDGHTQVLYEVTKKNGKIIKDRLFEVCFVTLKKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcgatagtagaaaacaatcatagagatttaattaataacctaaaaagaagagga
ataatcgacgatgatgatgtatatgatactatgctacaggtggatcgagggagatatata
aaagaaaacccttatatagacactccaatttacattagccatggtgtgactatttcgtcc
ccgcacatgcatgccctatccttaaagcgactcatgaatgtgctgaaacctgggtcgagg
gcgattgatgtcggttcaggatcaggatacctcacggtatgcatggcaatacgagtgaac
gttttggaaaataaaaattcgtttgttattggaatagaaagggtgaaagatttagttgac
ttttcaattgagaatataaaaagagataaacccgaattattaaatatagaaaattttaaa
attattcataaaaatatatatcaagttagtgaagaagaacagaaagaattggggttattc
gatgctattcatgtaggggcatcagctagtgaacttcctgatgtgttaataaatttacta
gcagaaaatggaaaactaattatacctttagaagacggacatacacaagttttatatgaa
gttacaaaaaaaaacggaaaaataattaaagatagattatttgaagtttgttttgttact
ttaaagaaaaattaa

DBGET integrated database retrieval system