KEGG   Plasmodium chabaudi: PC000179.00.0Help
Entry
PC000179.00.0     CDS       T01108                                 

Definition
protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PC000179.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 227 aa AA seqDB search
SNIMYAIVENNHRDLINNLKRRGIIDDDDVYDTMLQVDRGRYIKENPYIDTPIYISHGVT
ISSPHMHALSLKRLMNVLKPGSRAIDVGSGSGYLTVCMAIRVNVLENKNSFVIGIERVKD
LVDFSIENIKRDKPELLNIENFKIIHKNIYQVSEEEQKELGLFDAIHVGASASELPDVLI
NLLAENGKLIIPLEDGHTQVLYEVTKKNGKIIKDRLFEVCFVTLKKN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
tcaaatattatgtatgcgatagtagaaaacaatcatagagatttaattaataacctaaaa
agaagaggaataatcgacgatgatgatgtatatgatactatgctacaggtggatcgaggg
agatatataaaagaaaacccttatatagacactccaatttacattagccatggtgtgact
atttcgtccccgcacatgcatgccctatccttaaagcgactcatgaatgtgctgaaacct
gggtcgagggcgattgatgtcggttcaggatcaggatacctcacggtatgcatggcaata
cgagtgaacgttttggaaaataaaaattcgtttgttattggaatagaaagggtgaaagat
ttagttgacttttcaattgagaatataaaaagagataaacccgaattattaaatatagaa
aattttaaaattattcataaaaatatatatcaagttagtgaagaagaacagaaagaattg
gggttattcgatgctattcatgtaggggcatcagctagtgaacttcctgatgtgttaata
aatttactagcagaaaatggaaaactaattatacctttagaagacggacatacacaagtt
ttatatgaagttacaaaaaaaaacggaaaaataattaaagatagattatttgaagtttgt
tttgttactttaaagaaaaattaa

DBGET integrated database retrieval system