KEGG   Plasmodium chabaudi: PC000187.03.0Help
Entry
PC000187.03.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
pcb  Plasmodium chabaudi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pcb00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 488 aa AA seqDB search
ENISVFELFFRKCPFKGEFAVLGGVHEVIKYINCFRFTQRQLEYIRKKMSHYEYIDEFVD
YLKGVNGSRLSIHSMEEGSIVFANEPLITLEGPLLICQILESAILNLINYPTLIATNSMM
HKISINQKTLAEFGCRRAQGPDGALSGSRYAYAGADFTSNVYASFLYDIPILGTMSHSFI
LSFKGDQSVPNKYLDNHDFLSIVNKNKEIVHKLYDCKNANESELLAFVAFAQINPKMFIS
LIDTYSTLESGIFNFLIVALSLHEINYKPIGIRIDSGDLKQLSNECKKIFIDISSKLNVP
FNELKICISNDINEKVIQTFNQDKHHIDMFAIGTNLITCQSQPSLGLVFKLVQINNQPCF
KITNENIKSNYPYKKMLYRLYTEDDYVSVDYIQQCDAPQPLQNKEITCIDMLNQCKKIVI
TPKQIENKLLHVWDNGKLLITFKTIHEIKQYTLNEIKKLKKDHFSTYDPIRYHLLFSESY
YELYKKLI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gaaaatatctcagtcttcgaattattttttcgtaaatgcccttttaaaggagaatttgct
gttttaggaggcgtacatgaagttataaaatatattaattgttttcgttttacacaaaga
caattagaatatataagaaaaaaaatgtcacattatgagtatatcgacgaatttgttgat
tatttaaaaggtgtaaatggatctcgtttatctattcacagtatggaagaagggtcaata
gtttttgcaaatgagccattaataacattagaaggaccattattaatatgtcagatatta
gaaagcgctattttaaatttaataaactatcctactttaatagctacaaatagtatgatg
cataaaatttctataaaccaaaaaacattagctgaatttggttgtagaagagctcaaggg
ccggatggcgcattaagtggatcgagatatgcttatgctggcgccgattttacatcaaat
gtatatgcatcttttctatatgatatacctatattaggaacaatgtcacattcatttata
ctatcgtttaaaggcgatcaatctgtacctaataaatatttagataatcatgatttttta
agcatagtaaataaaaacaaagaaattgtccataagttatatgattgcaaaaatgctaat
gaaagtgaattattggcatttgtggcttttgctcaaattaatccaaagatgttcattagc
ttaatagatacatatagcacattagagtctggaattttcaactttctaatagtagcatta
tcgttacatgaaataaattataagcctattggtatacgtatcgattcgggtgacttaaaa
caattatcaaatgagtgtaaaaaaatatttattgacatatcaagtaaattaaatgttcct
tttaatgagctcaaaatttgtattagtaatgatattaatgaaaaagtaattcaaactttc
aatcaagataagcatcatattgatatgtttgccattggaacaaatttaataacatgccaa
tcacagccatcattaggtcttgtttttaagttagtgcagattaataatcaaccatgcttt
aaaataacaaatgagaatataaaatcgaattatccatataaaaaaatgctttatagatta
tatactgaagatgattatgtatcagttgattatatacaacagtgcgatgcaccacaacct
ttgcaaaacaaagaaattacatgtattgatatgctaaaccaatgcaaaaaaatagttatt
acacccaaacaaatcgaaaataaattattgcatgtatgggataacggaaaattattaatc
accttcaagacaatacacgaaataaaacaatatacattaaatgaaataaaaaaattaaaa
aaagaccatttttctacatatgacccaatacgataccatcttctcttttctgaaagttac
tacgaactatataaaaaattaatttaa

DBGET integrated database retrieval system