KEGG   Plasmodium chabaudi: PC000189.01.0Help
Entry
PC000189.01.0     CDS       T01108                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pcb  Plasmodium chabaudi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pcb00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 230 aa AA seqDB search
PINVAILGSTGSIGTSTLSIIRECNKIEKRFNVEALYVNKNVEGIYEQAKEFLPKYVCIH
DPSKYEELKKLLENIKNYNPIILIGDEGMKQICSSNEIDKIVIGIDSFQGLYSTIYAIKN
NKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSEHNAIFQCLNNNILLKSKCLQENF
SKLNQINKIFLCSSGGPFQNLSIDELKNVTSEKALKHPKWNMGKKISIDS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ccaataaatgttgccattttgggaagtactgggagtataggaactagcacccttagtatt
ataagagaatgcaacaaaatagaaaaacgatttaatgttgaagctttatatgttaataaa
aatgttgaaggaatatatgaacaagctaaagaatttttaccaaaatatgtgtgtatacat
gatccaagtaaatatgaagaattaaaaaaattattagaaaatataaagaattataatcca
ataatattaataggtgatgaaggtatgaaacaaatatgtagtagtaatgaaatagataaa
atagttattggtattgattcatttcaaggtttatattcaacaatatatgcaataaaaaat
aataaaactattgcattagcaaataaagaatctattgtatcagctgggtttttcttaaaa
aaattattaactgttcataaaaattcgacaataataccagtagattctgaacataatgca
atattccaatgtttaaataataatatattattaaaatcaaaatgtttgcaagaaaatttt
tctaaactaaatcaaataaataaaatatttttatgttcatctggtggaccatttcaaaac
ttatcaatagacgaactaaaaaatgtaacatctgaaaaagctttaaaacatccaaaatgg
aatatggggaaaaaaatatcaatcgattca

DBGET integrated database retrieval system