KEGG   Plasmodium chabaudi: PC000195.04.0Help
Entry
PC000195.04.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pcb  Plasmodium chabaudi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 118 aa AA seqDB search
MVSKKPAKEKKATNGAADGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFL
VDTFEKIATEASRLCKYTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatccaaaaagccagctaaagaaaaaaaagcaaccaatggtgctgctgatggaaaa
aaaaaaagaaaaaagtcaagatatgacagctatggactttacatatttaaagttttgaaa
caagtccacccagacactggtatttcaagaaaatccatgaacatcatgaactccttcctt
gttgataccttcgaaaaaatcgcaactgaagcatcaagattatgtaaatacaccaaaaga
gataccttatcatcccgtgaaatccaaactgctataagattagtattaccaggagaatta
gcaaaacacgccgtatctgaaggaacaaaagctgttacaaaatttacctccaaataa

DBGET integrated database retrieval system