KEGG   Plasmodium chabaudi: PCHAS_090250Help
Entry
PCHAS_090250      CDS       T01108                                 

Gene name
PC000195.04.0
Definition
(RefSeq) histone H2B, putative
  KO
K11252  histone H2B
Organism
pcb  Plasmodium chabaudi
Brite
Chromosome and associated proteins [BR:pcb03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PCHAS_090250 (PC000195.04.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PCHAS_090250 (PC000195.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa TAF
Motif
Other DBs
NCBI-GeneID: 3496450
NCBI-ProteinID: XP_743348
UniProt: A0A077XBR7
Position
9
AA seq 118 aa AA seqDB search
MVSKKPAKEKKATNGAADGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFL
VDTFEKIATEASRLCKYTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatccaaaaagccagctaaagaaaaaaaagcaaccaatggtgctgctgatggaaaa
aaaaaaagaaaaaagtcaagatatgacagctatggactttacatatttaaagttttgaaa
caagtccacccagacactggtatttcaagaaaatccatgaacatcatgaactccttcctt
gttgataccttcgaaaaaatcgcaactgaagcatcaagattatgtaaatacaccaaaaga
gataccttatcatcccgtgaaatccaaactgctataagattagtattaccaggagaatta
gcaaaacacgccgtatctgaaggaacaaaagctgttacaaaatttacctccaaataa

DBGET integrated database retrieval system