KEGG   Plasmodium chabaudi: PC000213.02.0Help
Entry
PC000213.02.0     CDS       T01108                                 

Definition
ubiquitin C-terminal hydrolase, family 1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PC000213.02.0
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PC000213.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
RYKEHNVPENLFFARQVIPNACATQAILSIIFNKNIQLNENIENIKTFSINFDSTMKGLT
LSNCNFLRNIHNSFKTPIYIENDDLYHDKKKESNSFHFVSYIEFEKSVYLLDGLQEGPIL
ITDENSDEQTGLANDWITIARNHIKKDINIMSTSNEDTENRFNILTIVKDKQSIIEEYIN
IHRILKQRANIKLVSLGEDIELHDEINEDDYSFSNKIPSIDQLPSDIEKLHNISNKSSIE
INYLEKLLTKEIELKASWDKERTFKFFNFYPFIISSINLMAKHKILKPSYEKEKQKRST
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
agatataaagaacataatgtacctgaaaatttattttttgctagacaggttattccgaat
gcatgtgcaacacaagctatattatccatcatatttaacaaaaatatacaattaaatgaa
aatatagaaaatataaaaacatttagtataaattttgatagtactatgaaaggattaaca
ttatctaattgtaactttttacgaaatattcataattcttttaaaactccaatatatata
gaaaatgatgatttatatcatgacaaaaaaaaagaatcgaattcattccattttgtatct
tatattgaatttgaaaaaagtgtatatctattagatggtttgcaagaaggcccaatttta
attacggatgaaaattctgatgaacagacaggactagccaatgattggataaccatagca
aggaaccatataaaaaaagacataaatattatgagtacctctaacgaagatacagaaaac
agatttaatattttaacaatagtaaaggataaacagtctataatagaggaatatataaat
atacatagaatcctaaaacaaagagcaaatattaaactagtaagtttaggagaagatata
gaattacatgatgaaatcaatgaagatgattattctttttcaaataaaattcctagtatt
gatcaacttccatcggatattgagaaattacataacatttcaaacaaatcatcaatcgaa
attaattatttagaaaaactactgaccaaagaaatagaacttaaagcttcttgggataaa
gaacgaactttcaaattttttaatttctatcccttcataatatcttcaataaatttaatg
gcaaaacataaaattttaaagccatcctacgaaaaagaaaaacaaaaacgaagcacatga

DBGET integrated database retrieval system