KEGG   Plasmodium chabaudi: PC000282.05.0Help
Entry
PC000282.05.0     CDS       T01108                                 

Definition
eukaryotic translation initiation factor 3 subunit
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pcb  Plasmodium chabaudi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PC000282.05.0
Translation factors [BR:pcb03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PC000282.05.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 645 aa AA seqDB search
MVKVEESELSDKELVDFLSDDSDDGNETLLNKKYAGKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIRHLSAKISDSSIMNIKIHMPVDDEKKTKGICFVTFHDSFQANEA
VKVLNKLKLDAKHLLTASKMDDIENIINRDERVMPINVVGFTREKIRWWLYDEKCREQFI
VRYDSHFEVHWLDPLEKEPQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDNF
EKLIRLQHKSVKDISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEYSP
REKIFPHFLWSPDDKYIACIGKQKEVYIYELPSMLLLEDHEKKRTPLKYSVVKEFDWSPV
DNIVAIWIPETNNTPGTLILVEIPSRKELVSRKIYDVSQASIHWQSKGDYLCLKTTIVKK
IGKKGKKEHTQLEIFRMREKNIPVDNIQIEGVKTKQFHWEESNSNRFALIVRDEATSRQQ
IRFYKILNKGATRNVKWTSTFDINNQMNFMKWSPQGTFFILASLLSEGMLYFCFLNSNDE
VEVIHKDEHLLVNSVAWSNCGRYLVTSVSNLSGISSSNYKEENSETGFYIWTFQGRCLMT
VKKPSFYQFFFRPHPKSLFSDKLKIDIKNNLKDYSKKFDVIDEKI
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagttgaagaaagcgaattaagcgacaaggaacttgtcgattttttatcagat
gatagtgatgatggaaatgaaactttgttaaataaaaaatatgcaggaaaagaagccttg
attacacttgaaacaaagtttcctaaaatcgttacaatattaggtataccaaaagtagaa
gaagaaaaacatagtaggttagcagaagttttaaagaaattatttataaggcatttaagt
gccaaaataagtgattcttcaataatgaatataaaaatccatatgccagtagatgatgaa
aaaaaaacaaaaggaatatgctttgttacatttcatgatagttttcaagcaaatgaagca
gtaaaggtattaaataaattaaaattggatgcaaaacatttattaacagcatccaaaatg
gatgatatagaaaatataataaatagggatgagcgtgtaatgcctataaatgttgttggt
tttacaagagaaaaaatcagatggtggttatatgatgaaaaatgtcgagaacaatttatt
gttcgatatgatagtcattttgaagttcattggttagatcctttagaaaaagaaccacaa
ttaatttatactacatttaaaaagaatgctccgttctcaagtgtccaatggagtaaccaa
gggtcatacttagtcagttttcataacccaggtattgcattatggggtggagataatttt
gaaaaattaataaggctacaacataaaagtgttaaagatataagtttttcaccaaatgaa
aattatgtactaacttgggatggtactcctgcttcattaagaaatgaaaaatctatttgt
atatggagagtaataacaggaaaattgcttcgttcttttatcacacctgaatatagtcca
agagaaaaaatatttccccattttttatggagccctgatgataaatatattgcatgtata
ggaaaacaaaaagaagtatatatatatgaattaccatctatgttattattagaagatcat
gaaaaaaaaagaactccactaaaatattcagtcgttaaagagtttgattggtcacctgta
gataatatagttgcaatttggattccagaaacaaataatacaccaggaactttgatatta
gtagaaataccatctagaaaagaattagtatctagaaaaatttatgatgttagtcaagca
tctattcattggcaaagtaaaggagattatttatgtcttaaaacaactattgtaaaaaaa
attggaaaaaaaggaaaaaaagaacatacacaattagaaatatttagaatgagagaaaaa
aatatacctgtagataatatacaaatcgaaggagtaaaaacaaaacaatttcattgggaa
gaatcaaatagtaatagatttgcattaatagtaagagatgaagctacaagtagacaacaa
ataagattttataaaatattaaataaaggtgctacaagaaatgtaaaatggactagtaca
tttgatataaataatcaaatgaattttatgaaatggtcaccacaaggaaccttttttata
ttagcttccttactatcagaaggaatgttatatttctgtttcttaaattcaaatgatgaa
gttgaagttatacataaagatgaacatttgttagtaaattctgttgcatggagtaattgt
ggtagataccttgttacatctgtttcgaatttatctggtatatcaagttctaattataaa
gaagaaaatagtgaaacaggtttttatatatggacttttcaaggtagatgtttaatgact
gttaaaaaaccatcattttatcaattcttttttcgacctcatccaaaatcattatttagt
gataaattgaaaattgatataaaaaataatctaaaagattattctaaaaaattcgatgtt
atagatgaaaaaatt

DBGET integrated database retrieval system