KEGG   Plasmodium chabaudi: PCHAS_123310Help
Entry
PCHAS_123310      CDS       T01108                                 

Gene name
PC000282.05.0
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit, putative
  KO
K03253  
translation initiation factor 3 subunit B
Organism
pcb  Plasmodium chabaudi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PCHAS_123310 (PC000282.05.0)
Messenger RNA biogenesis [BR:pcb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PCHAS_123310 (PC000282.05.0)
Translation factors [BR:pcb03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PCHAS_123310 (PC000282.05.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
12
AA seq 716 aa AA seqDB search
MVKVEESELSDKELVDFLSDDSDDGNETLLNKKYAGKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIRHLSAKISDSSIMNIKIHMPVDDEKKTKGICFVTFHDSFQANEA
VKVLNKLKLDAKHLLTASKMDDIENIINRDERVMPINVVGFTREKIRWWLYDEKCREQFI
VRYDSHFEVHWLDPLEKEPQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDNF
EKLIRLQHKSVKDISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEYSP
REKIFPHFLWSPDDKYIACIGKQKEVYIYELPSMLLLEDHEKKRTPLKYSVVKEFDWSPV
DNIVAIWIPETNNTPGTLILVEIPSRKELVSRKIYDVSQASIHWQSKGDYLCLKTTIVKK
IGKKGKKEHTQLEIFRMREKNIPVDNIQIEGVKTKQFHWEESNSNRFALIVRDEATSRQQ
IRFYKILNKGATRNVKWTSTFDINNQMNFMKWSPQGTFFILASLLSEGMLYFCFLNSNDE
VEVIHKDEHLLVNSVAWSNCGRYLVTSVSNLSGISSSNYKEENSETGFYIWTFQGRCLMT
VKKPSFYQFFFRPHPKSLFSDKLKIDIKNNLKDYSKKFDVIDEKIRNSKKNQLISERKNV
ENSFNEKLEKITKLFQSFKEYELFRRNWETFESQFEWEEKTVVIEHVLSVKQEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagttgaagaaagcgaattaagcgacaaggaacttgtcgattttttatcagat
gatagtgatgatggaaatgaaactttgttaaataaaaaatatgcaggaaaagaagccttg
attacacttgaaacaaagtttcctaaaatcgttacaatattaggtataccaaaagtagaa
gaagaaaaacatagtaggttagcagaagttttaaagaaattatttataaggcatttaagt
gccaaaataagtgattcttcaataatgaatataaaaatccatatgccagtagatgatgaa
aaaaaaacaaaaggaatatgctttgttacatttcatgatagttttcaagcaaatgaagca
gtaaaggtattaaataaattaaaattggatgcaaaacatttattaacagcatccaaaatg
gatgatatagaaaatataataaatagggatgagcgtgtaatgcctataaatgttgttggt
tttacaagagaaaaaatcagatggtggttatatgatgaaaaatgtcgagaacaatttatt
gttcgatatgatagtcattttgaagttcattggttagatcctttagaaaaagaaccacaa
ttaatttatactacatttaaaaagaatgctccgttctcaagtgtccaatggagtaaccaa
gggtcatacttagtcagttttcataacccaggtattgcattatggggtggagataatttt
gaaaaattaataaggctacaacataaaagtgttaaagatataagtttttcaccaaatgaa
aattatgtactaacttgggatggtactcctgcttcattaagaaatgaaaaatctatttgt
atatggagagtaataacaggaaaattgcttcgttcttttatcacacctgaatatagtcca
agagaaaaaatatttccccattttttatggagccctgatgataaatatattgcatgtata
ggaaaacaaaaagaagtatatatatatgaattaccatctatgttattattagaagatcat
gaaaaaaaaagaactccactaaaatattcagtcgttaaagagtttgattggtcacctgta
gataatatagttgcaatttggattccagaaacaaataatacaccaggaactttgatatta
gtagaaataccatctagaaaagaattagtatctagaaaaatttatgatgttagtcaagca
tctattcattggcaaagtaaaggagattatttatgtcttaaaacaactattgtaaaaaaa
attggaaaaaaaggaaaaaaagaacatacacaattagaaatatttagaatgagagaaaaa
aatatacctgtagataatatacaaatcgaaggagtaaaaacaaaacaatttcattgggaa
gaatcaaatagtaatagatttgcattaatagtaagagatgaagctacaagtagacaacaa
ataagattttataaaatattaaataaaggtgctacaagaaatgtaaaatggactagtaca
tttgatataaataatcaaatgaattttatgaaatggtcaccacaaggaaccttttttata
ttagcttccttactatcagaaggaatgttatatttctgtttcttaaattcaaatgatgaa
gttgaagttatacataaagatgaacatttgttagtaaattctgttgcatggagtaattgt
ggtagataccttgttacatctgtttcgaatttatctggtatatcaagttctaattataaa
gaagaaaatagtgaaacaggtttttatatatggacttttcaaggtagatgtttaatgact
gttaaaaaaccatcattttatcaattcttttttcgacctcatccaaaatcattatttagt
gataaattgaaaattgatataaaaaataatctaaaagattattctaaaaaattcgatgtt
atagatgaaaaaattagaaactctaaaaagaatcaattaatttcagaaagaaaaaatgtt
gaaaattcatttaatgaaaaattggagaaaatcacaaaattatttcaatcctttaaagaa
tatgaactgttcagaagaaattgggaaacatttgaaagccaatttgaatgggaagaaaaa
acagttgtcatcgaacatgtcctttctgttaagcaggaaatcttcgcatag

DBGET integrated database retrieval system