KEGG   Plasmodium chabaudi: PCHAS_081370Help
Entry
PCHAS_081370      CDS       T01108                                 

Gene name
PC000289.02.0
Definition
(RefSeq) conserved Plasmodium protein, unknown function
  KO
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCHAS_081370 (PC000289.02.0)
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PCHAS_081370 (PC000289.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 445 aa AA seqDB search
MNRYMNIILFFCVCAQYVICQADQIINERLDRLVFLSCNNHRKKPNTNLIKSIEKKKPQL
MLWIGDYFYSGCRELTCLKEAYEYIKKDEYYINIKKKFTIDGIYDDHDYSCNNGDRLFKY
KKESKKMYLDYLGIDKNDIRYKRSGAYFSKLYIDPNDENNQVKIIVLDTRYNKDPYPYYS
FESRTDQFIYKIFSLASRIHASLFGLYCNSPNDILGEEQWKWFENELTNSKARAHIVISS
IQVFANYIMNETWGLMPAALKRLKALVKKTKPKGLVFLSGDVHYSCILGNEEDIVEVTSS
NVNQENDYSPIIQYFVYYISYILNKATPFKFDKIYGFSNYGEINISYPNKNKINLKISIN
NSNGEEVMSANQTFDNKKDIYVKTKDIHLIHDDFACLSCKSKIKVFMILIAYILCILWIV
QIFIIIFKKIFNKKGTKDIYDIKED
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaataggtatatgaatataattttatttttttgtgtgtgtgcacaatatgtgatctgt
caggcagatcagataattaacgaaaggctggacaggctagtttttttaagttgtaataat
cataggaaaaaacccaacaccaatttaataaaatcaattgaaaagaaaaagccgcagtta
atgttatggataggagattacttttattcgggatgcagagaattgacatgcctaaaagaa
gcatatgaatatattaaaaaagatgaatattatataaatataaaaaagaaatttacaatt
gatggaatttatgatgatcatgattatagttgtaacaatggagatcgtttatttaaatat
aaaaaagaaagtaaaaaaatgtatttagattatttaggtattgataaaaatgatataaga
tataaaagaagtggagcatatttttctaaattatatatagatccaaatgatgaaaataat
caagttaaaattattgttttagatacacgatataataaagatccttatccatattattcg
ttcgaatcacgtaccgatcaatttatttataagatattttctttagcatctcgtatacat
gcatccttatttggattatattgcaatagtcccaatgatatattaggagaagaacaatgg
aaatggtttgaaaatgaattgactaattccaaagctcgtgctcacattgttatatcatct
atacaggtgttcgccaattatataatgaacgaaacttggggtttgatgcctgcggcttta
aagagattaaaagcgttagtaaaaaaaacaaaacccaagggattagtatttttaagtggt
gatgtacactatagttgtatacttggaaatgaggaagatatcgttgaagtaacaagcagt
aatgtaaatcaagaaaatgattatagtcctattattcaatattttgtttattatatttca
tatattttaaataaagccacaccttttaaattcgataaaatatatggatttagtaattat
ggtgaaattaatatttcttacccaaataaaaataaaataaatcttaaaatttctataaat
aattcaaatggcgaagaagttatgtcagctaatcaaacctttgataataaaaaagatata
tatgtcaaaacaaaagatattcatttaatacatgatgattttgcatgtttatcatgtaaa
agtaaaataaaagtatttatgattttgattgcttatatattatgtatattatggatcgtt
caaatttttatcattatttttaaaaaaattttcaacaaaaaaggtacaaaagatatatat
gatattaaggaagattaa

DBGET integrated database retrieval system