KEGG   Plasmodium chabaudi: PC000289.02.0Help
Entry
PC000289.02.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PC000289.02.0
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PC000289.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MNRYMNIILFFCVCAQYVICQADQIINERLDRLVFLSCNNHRKKPNTNLIKSIEKKKPQL
MLWIGDYFYSGCRELTCLKEAYEYIKDEYYINIKKKFTIDGIYDDHDYSCNNGDRLFKYK
KESKKMYLDYLGIDKNDIRYKRSGAYFSKLYIDPNDENNQVKIIVLDTRYNKDPYPYYSF
ESRTDQFIYKIFSLASRIHASLFGLYCNSPNDILGEEQWKWFENELTNSKARAHIVISSI
QVFANYIMNETWGLMPAALKRLKALVKKTKPKGLVFLSGDVHYSCILGNEEDIVEVTSSN
V
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaataggtatatgaatataattttatttttttgtgtgtgtgcacaatatgtgatctgt
caggcagatcagataattaacgaaaggctggacaggctagtttttttaagttgtaataat
cataggaaaaaacccaacaccaatttaataaaatcaattgaaaagaaaaagccgcagtta
atgttatggataggagattacttttattcgggatgcagagaattgacatgcctaaaagaa
gcatatgaatatattaaagatgaatattatataaatataaaaaagaaatttacaattgat
ggaatttatgatgatcatgattatagttgtaacaatggagatcgtttatttaaatataaa
aaagaaagtaaaaaaatgtatttagattatttaggtattgataaaaatgatataagatat
aaaagaagtggagcatatttttctaaattatatatagatccaaatgatgaaaataatcaa
gttaaaattattgttttagatacacgatataataaagatccttatccatattattcgttc
gaatcacgtaccgatcaatttatttataagatattttctttagcatctcgtatacatgca
tccttatttggattatattgcaatagtcccaatgatatattaggagaagaacaatggaaa
tggtttgaaaatgaattgactaattccaaagctcgtgctcacattgttatatcatctata
caggtgttcgccaattatataatgaacgaaacttggggtttgatgcctgcggctttaaag
agattaaaagcgttagtaaaaaaaacaaaacccaagggattagtatttttaagtggtgat
gtacactatagttgtatacttggaaatgaggaagatatcgttgaagtaacaagcagtaat
gta

DBGET integrated database retrieval system