KEGG   Plasmodium chabaudi: PC000298.03.0Help
Entry
PC000298.03.0     CDS       T01108                                 

Definition
cGMP-dependent protein kinase 1, beta isozyme
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PC000298.03.0
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PC000298.03.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 632 aa AA seqDB search
MISSREGSYFFIINSGKFDVYVNDKKVKTLTKGSSFGEAALIHNTQRSATIKAGTNGTLW
GVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQNFKPGETIVK
QGDYGDVLYILKDGKATVYINDEEIRVLEKGSYFGERALLYDEPRSATIIAKEVTSCASI
CRKLLNVVLGNLQVVLFRNIMTEALQQSEIFKQISPDQLNDLADTAIVRDYPANYNILHK
DKIKSVKYIIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQKFKHTLKSLEVCKIAL
ITESCLADCLGNNNIDASIDHNNKKSIIKKMYIFRYLTDKQCNLLIEAFKTTRYEEGDYV
IQEGEVGSRFYIIKTGEVEIVKNNKRLRTLGKNDYFGERALIYDEPRTASVISTVNNLEC
WYVDKSVFLQIIEGPMLAHLEERIKMQDTKVEMSELLTERIIGRGTFGIVKLVLHEPTKI
RYALKCVSKKSIIELNQQNNIKLEREITAENDHPFIIRLVRTFKDSKYFYFLTELVTGGE
LYDAIRKLGLLSRSQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGC
AKKIHGRSYTLVGTPHYMAPEVILGKGYGCTV
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctcgcgcgaaggttcctactttttcattataaatagcggaaaattcgatgta
tatgtaaatgacaaaaaagtgaaaactttgaccaagggtagctcatttggggaagccgct
ttaatacacaatactcaaagaagtgctactataaaagcaggaacgaatgggacattatgg
ggggtgcaaagaagtacattcagagcaactttaaaacaattatccaatagaaattttaat
gaaaatagaagtttcattgattccgtatctgtttttgatatgctaacagaagcacaaaaa
aatatgataaccaatgcatgtgttatacaaaattttaaacccggagaaacaatagttaag
caaggagattatggagatgttctatacattttgaaagacggaaaagcaactgtatatatt
aatgatgaagaaatcagagttctagaaaagggatcatacttcggagagagagctcttctg
tacgatgaaccgcgaagtgctacaattatcgctaaggaagtgacatcttgtgcatctatt
tgtcgaaaattgttaaatgtagttcttggaaatttacaagtagtattgtttcgtaacatt
atgacagaggctcttcaacagagtgaaatatttaagcaaataagtccagatcaattaaat
gatttagctgatacagctatagttagagattatccagcaaactataatatattacataaa
gataagataaaaagtgtaaaatatataatagtattagaaggaaaagtagaattatttctt
gatgacgaatcgattggaatattgacaagaggtaaatcatttggagatcaatacgtactt
aatcaaaaacaaaaatttaagcatacattaaaatcgttagaggtatgtaaaatagcatta
attacagaatcttgtttagccgattgtttaggaaataataatatagatgcatctatagat
cataataataaaaaaagtatcataaaaaaaatgtatatttttcgatatttaactgataaa
caatgtaatttacttatcgaagcatttaaaacaactcgatatgaagaaggagattacgtt
atacaagaaggtgaagtagggtcaagattttatataataaaaactggagaagtagaaata
gtaaaaaataataaaagactaagaacattagggaaaaatgattattttggcgaaagagcc
ttaatttatgatgaaccaagaacggcatcagttataagtactgtaaacaatttagaatgt
tggtatgttgataaatcagtttttttacaaattattgaaggacctatgttagcacatttg
gaagaaagaattaaaatgcaagatactaaagtagaaatgtcagagttattaacagaaaga
attataggtagaggtacatttggtattgttaagctagttttacatgaacccacaaaaatt
agatatgcattaaaatgtgttagtaaaaaaagtattatagaattaaaccaacaaaataat
atcaaactagaaagagaaattactgctgaaaatgaccatccatttattattaggttagta
agaacattcaaagattctaaatatttttattttttaacggagttagttactggaggagaa
ctttatgatgctattagaaagttaggtttattatcaagatcacaagcacagttttattta
ggctctataatattagcaatcgaatatttacatgaaagaaatatagtgtatcgagatcta
aaacctgaaaacatcttattagataagcaaggatatgtcaaattaatcgattttggttgt
gcaaaaaaaatacatggaagatcatatacattagtaggaacaccacattatatggcacct
gaagttatattaggaaaaggatatggatgcacggtt

DBGET integrated database retrieval system