KEGG   Plasmodium chabaudi: PCHAS_100910Help
Entry
PCHAS_100910      CDS       T01108                                 

Gene name
PC000298.03.0
Definition
(RefSeq) cGMP-dependent protein kinase, putative
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PCHAS_100910 (PC000298.03.0)
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PCHAS_100910 (PC000298.03.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 854 aa AA seqDB search
MDDDDEIIPKKNNERNKKKAIFSNEEFSGEDNLMEDHLELRDKLAEDIVTIKTSLKNNLV
CSTLNDNEILALSNYMQFFVFKSGDMVIKQGEKGSYFFIINSGKFDVYVNDKKVKTLTKG
SSFGEAALIHNTQRSATIKAGTNGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFD
MLTEAQKNMITNACVIQNFKPGETIVKQGDYGDVLYILKDGKATVYINDEEIRVLEKGSY
FGERALLYDEPRSATIIAKEVTSCASICRKLLNVVLGNLQVVLFRNIMTEALQQSEIFKQ
ISPDQLNDLADTAIVRDYPANYNILHKDKIKSVKYIIVLEGKVELFLDDESIGILTRGKS
FGDQYVLNQKQKFKHTLKSLEVCKIALITESCLADCLGNNNIDASIDHNNKKSIIKKMYI
FRYLTDKQCNLLIEAFKTTRYEEGDYVIQEGEVGSRFYIIKTGEVEIVKNNKRLRTLGKN
DYFGERALIYDEPRTASVISTVNNLECWYVDKSVFLQIIEGPMLAHLEERIKMQDTKVEM
SELLTERIIGRGTFGIVKLVLHEPTKIRYALKCVSKKSIIELNQQNNIKLEREITAENDH
PFIIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSRSQAQFYLGSIILAIEYLHER
NIVYRDLKPENILLDKQGYVKLIDFGCAKKIHGRSYTLVGTPHYMAPEVILGKGYGCTVD
IWALGVCLYEFICGPLPFGNDQEDQLEIFRDILTGQLTFPDYVTDTDSINLIKRLLCRLP
QGRIGCSINGFKDIKENPFFSDFDWDRLAGRLLEPPLISKSETYAEDIDVKQIEQEEEDN
ANAEIDDENWDIDF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatgatgaaataattccaaagaaaaataatgaaagaaataagaaaaaggca
attttctctaatgaagaattctcaggggaggataatttaatggaggatcacctagaattg
agggataaattggcagaagatatcgtcactataaaaacttccctaaaaaataatcttgta
tgtagtacactaaatgataatgaaatattagcactgtctaattatatgcaattttttgtt
ttcaaaagtggagatatggtcataaagcaaggagaaaaaggttcctactttttcattata
aatagcggaaaattcgatgtatatgtaaatgacaaaaaagtgaaaactttgaccaagggt
agctcatttggggaagccgctttaatacacaatactcaaagaagtgctactataaaagca
ggaacgaatgggacattatggggggtgcaaagaagtacattcagagcaactttaaaacaa
ttatccaatagaaattttaatgaaaatagaagtttcattgattccgtatctgtttttgat
atgctaacagaagcacaaaaaaatatgataaccaatgcatgtgttatacaaaattttaaa
cccggagaaacaatagttaagcaaggagattatggagatgttctatacattttgaaagac
ggaaaagcaactgtatatattaatgatgaagaaatcagagttctagaaaagggatcatac
ttcggagagagagctcttctgtacgatgaaccgcgaagtgctacaattatcgctaaggaa
gtgacatcttgtgcatctatttgtcgaaaattgttaaatgtagttcttggaaatttacaa
gtagtattgtttcgtaacattatgacagaggctcttcaacagagtgaaatatttaagcaa
ataagtccagatcaattaaatgatttagctgatacagctatagttagagattatccagca
aactataatatattacataaagataagataaaaagtgtaaaatatataatagtattagaa
ggaaaagtagaattatttcttgatgacgaatcgattggaatattgacaagaggtaaatca
tttggagatcaatacgtacttaatcaaaaacaaaaatttaagcatacattaaaatcgtta
gaggtatgtaaaatagcattaattacagaatcttgtttagccgattgtttaggaaataat
aatatagatgcatctatagatcataataataaaaaaagtatcataaaaaaaatgtatatt
tttcgatatttaactgataaacaatgtaatttacttatcgaagcatttaaaacaactcga
tatgaagaaggagattacgttatacaagaaggtgaagtagggtcaagattttatataata
aaaactggagaagtagaaatagtaaaaaataataaaagactaagaacattagggaaaaat
gattattttggcgaaagagccttaatttatgatgaaccaagaacggcatcagttataagt
actgtaaacaatttagaatgttggtatgttgataaatcagtttttttacaaattattgaa
ggacctatgttagcacatttggaagaaagaattaaaatgcaagatactaaagtagaaatg
tcagagttattaacagaaagaattataggtagaggtacatttggtattgttaagctagtt
ttacatgaacccacaaaaattagatatgcattaaaatgtgttagtaaaaaaagtattata
gaattaaaccaacaaaataatatcaaactagaaagagaaattactgctgaaaatgaccat
ccatttattattaggttagtaagaacattcaaagattctaaatatttttattttttaacg
gagttagttactggaggagaactttatgatgctattagaaagttaggtttattatcaaga
tcacaagcacagttttatttaggctctataatattagcaatcgaatatttacatgaaaga
aatatagtgtatcgagatctaaaacctgaaaacatcttattagataagcaaggatatgtc
aaattaatcgattttggttgtgcaaaaaaaatacatggaagatcatatacattagtagga
acaccacattatatggcacctgaagttatattaggaaaaggatatggatgcacggttgat
atatgggcattaggtgtttgcttatatgaatttatatgtggtccattacccttcggtaat
gatcaagaagatcaattagaaatatttagagacatattaacagggcaattaactttccca
gactatgttactgatactgatagcattaatttaattaaaagattattatgtagattaccc
caaggaagaattggatgctccataaatggattcaaagatattaaagaaaatccatttttt
tccgattttgattgggatagattagctggacgtttgcttgaacctcctctcatttcgaaa
agcgaaacttatgcagaggatatcgatgttaagcaaatcgaacaagaagaggaagataat
gccaatgccgaaattgatgatgaaaattgggatattgatttttaa

DBGET integrated database retrieval system