KEGG   Plasmodium chabaudi: PC000316.01.0Help
Entry
PC000316.01.0     CDS       T01108                                 

Definition
histone acetyltransferase Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PC000316.01.0
Transcription machinery [BR:pcb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PC000316.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
QSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDREPDHLIKLITLKNIFSRQLPKMP
REYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEIAFLAVTSTEQVKGYGTRLM
NHLKEHVKKFGIEYFLTYAGLFLFTLTDLTMNALVDVLFSDNFAIGYFRKQGFSQKISMP
KERWFGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKAIHFIKPQIIFKGLNYF
TENKGGNLHPSNIPGLLEIGWKKEYKDMAAKKTQHKEVQLKDQIINVLDYLEKQQSAWPF
LKPVSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIELKRMFDNCRLYNAPTTI
YFKYANELQALIWPKYEEISEMAK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
cagtccctacttccttccgaaactgggttgggatatctgcatcgagacgcaggaggagcg
aaagaagagaacatgggaatcatcacctttgagtgcataacaaatgatagagaaccagat
cacttaattaaattaataacattaaaaaatatattttcaaggcaattacctaaaatgcct
agagaatatattgtcagacttgtatttgatagaaatcattatacattttgtttattaaaa
aaaaatacagtaattggtggtgtctgttttagaccttatttcgaacaaaaatttgctgaa
attgcatttttagcagttacatcaacagagcaagtaaaaggatatggtactcgtcttatg
aaccatttaaaagagcatgtaaaaaaatttggaattgaatattttctaacttatgcaggc
ttatttttatttacattaactgacttaacaatgaatgcacttgttgatgttcttttttca
gataactttgctataggatattttagaaaacaaggattttcacaaaagatttcgatgcca
aaagaaagatggtttggatatataaaagattatgatggaggtacattaatggaatgttat
attttcccaaatataaattatttaagattatctgaaatgttatatgaacaaaaaaaaaca
gtcaaaaaagctatacattttataaaacctcaaattatatttaaaggattaaattatttt
actgaaaataaaggaggaaatttacatcctagtaatataccaggcttattagaaatcgga
tggaaaaaagaatataaagatatggcagcaaaaaaaacacaacataaagaagttcaacta
aaagatcaaattataaatgttcttgattatttggaaaaacaacaatctgcttggccattt
ttaaaacctgttagtctttctgaagccccagattattatgacattatcaaagagcctact
gatatattgacgatgcgaaggaaggcccgtcacggcgagtataaaacgaaggaagacttt
ggtattgagctgaagaggatgtttgataactgtcgattgtacaacgctccgacgacgata
tactttaaatatgctaatgaattacaagccttaatctggcctaaatacgaagaaattagc
gaaatggcaaagtaa

DBGET integrated database retrieval system