KEGG   Plasmodium chabaudi: PCHAS_145980Help
Entry
PCHAS_145980      CDS       T01108                                 

Gene name
PC000320.04.0
Definition
(RefSeq) transcription factor Tfb2, putative
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pcb  Plasmodium chabaudi
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PCHAS_145980 (PC000320.04.0)
  Replication and repair
   03420 Nucleotide excision repair
    PCHAS_145980 (PC000320.04.0)
Transcription machinery [BR:pcb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PCHAS_145980 (PC000320.04.0)
DNA repair and recombination proteins [BR:pcb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PCHAS_145980 (PC000320.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
14
AA seq 922 aa AA seqDB search
MVKARKNIENMEIYDYMKEMDAKIWEYLFDDSLAHETIFNSLNELEQIIISRLLFIQQVV
SERAMRLWINPNFLKKLSESIKNLVDVKILVESETKKDNYNQYKINDRFRLTLLNKIYQN
DKSNIFIFNNNIKLQLNKEKELYEKKLFPTKEGILCYASARWNTLLHFIASPNLNSYKYS
HSYSGSYASTYPHSSSIHGGIDSPIKTEMGTSIDPNNVHSYGGEYSYNNSLKSVKVEKGN
YYGTQTKKSRKNNEDSDEEYQPYGDEMYDDENYENESFSQRRKYKSYGEYENTGNDSEYD
EDEGYEDESNEQYDNQTRNKYSQNYNDIENSNSGKYLNPRMGNKENVNLYDPNKKRDGRR
GRKKKKGVYAYKQNNLYYKSLQSRENNNMEEENNDFFFSSSNIKKEDLLACAPCGSLIEV
LKKKKFILDDVNNSSNIANNNNNNKTINMSREAFSWFLKDIRSRIISLVIEYLLIIDDGN
VTNIAKQNSAKHKKKGNSENVISNDGNEALPNSSISNTLINDYNNNDNMNNNNVNGGEWG
TNNEDMNNADGLNMNIKDAQDYITDPNKNSQKSEIYIKETLLFILSLTQCNIGQPIFLEN
LTKAQKEFVDFGIHIGLFLKTHDSYIFITPYALLLTINNLNVENYISILNHLSVEKFCEE
SGYNNNEDENIKKKAKLSEIYFHKYLLIQNTVRVKSEPLMDEDEKKDMKKFETKNYISQD
ITNHNIHSEKRLNENDNLEIGLIIQSNFKVYLYTSSILKINILSHLCELQARTPNMVVGI
LTRRSVLNAYNSDITADQIIKFLESYSHPGKTKLKSIIPINVITQLKLWEAERHRLTLED
SIVFKNFEKEYLPHLYQQIVIWANSKNYLLHYTPWPKNTNSPEFDAWMKTEKYLCCIYES
KNEIIDKIKEIRGKLMKKRQAI
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcacggaaaaatattgagaatatggaaatatatgactacatgaaggagatg
gatgcaaagatatgggaatatttatttgatgactcactagcacatgagacgatatttaac
tcactaaatgaattagagcaaattataatatctaggctattgtttattcaacaagtagtt
tcagaaagagctatgagattatggataaatccaaattttttgaaaaaattaagtgagagt
ataaaaaatttagttgatgttaaaatattagttgaaagtgaaacaaaaaaagataactat
aatcaatataaaataaatgatcgattcagattaacattattaaataaaatatatcaaaat
gataaaagtaatatttttatatttaataataatataaaactacaactaaataaagaaaaa
gaattatatgaaaaaaaattatttcctacaaaagaaggtattctatgttatgccagtgca
agatggaatactctcttgcattttattgcatcaccaaatttgaatagttataaatatagt
catagttatagtggtagttatgctagtacttacccacacagtagtagcatccatggtggt
atagattcccctataaaaacagagatgggaacttcgatcgatccaaataatgttcattct
tatggaggggaatattcttataataatagtttgaaaagtgtgaaagtagaaaaaggaaac
tattatggtactcaaactaaaaaaagcagaaaaaataatgaagacagtgatgaagaatat
caaccttatggtgatgaaatgtatgatgatgaaaattatgaaaacgaatcattttcacaa
agaaggaaatataaaagttatggagaatatgaaaacacaggaaatgattcagaatatgac
gaggatgaaggttatgaagatgaatcaaatgagcaatatgacaatcaaacacgaaataaa
tattcacaaaattataatgacattgaaaatagtaatagtggtaaatatttaaacccaaga
atgggtaataaagaaaatgtaaatttatacgatcctaataaaaaaagagatggaagacga
gggagaaagaaaaaaaaaggagtctatgcatataaacaaaataatttatattataaaagt
cttcaaagtagagaaaataataatatggaagaagaaaataatgatttttttttttcttca
tcaaatattaaaaaagaagatttgttagcatgtgcaccatgtggtagtttgatagaagtt
ttgaaaaaaaaaaaatttatacttgatgatgtaaataatagttctaacattgctaataat
aacaataataataaaacaataaatatgagtagagaagcattttcatggtttttaaaagat
ataagaagtagaataatatctttagttattgaatatttattaataattgatgatgggaat
gtaacaaatatagctaagcaaaattcagctaaacataaaaaaaaaggcaattcagaaaat
gtgatttctaatgatgggaatgaagcattaccaaatagttccatctcaaatactcttata
aatgattataacaataatgataatatgaataataataatgtaaatggaggagagtggggt
actaacaatgaagatatgaataatgcagatggtctaaatatgaatataaaggatgcacaa
gattatataacagatccaaataaaaattctcaaaaatcagaaatatatataaaagaaaca
ttattatttattttatcattaacccaatgtaatattggtcaaccaatatttttagaaaac
ttaacaaaagctcaaaaagaatttgtagactttggtatacatataggcttatttttaaaa
acacatgatagttatatatttataacaccatatgcattattattaacaataaataattta
aatgtagaaaattatatatctatattaaatcatttatctgtagaaaaattttgtgaagaa
tctggttataataataatgaagatgaaaatataaaaaaaaaagctaaattaagtgaaata
tattttcataaatatttattaatacaaaatacggttcgtgtgaagagtgagccattaatg
gatgaggatgagaaaaaagatatgaaaaaatttgaaacaaaaaattatatttcacaagac
ataactaatcataatatacattcagaaaaaagattaaatgaaaatgataatttagaaata
gggttaattattcaaagtaattttaaagtttatttatatacttcatcaattttaaaaata
aatattttaagtcatttatgtgaattacaagcaagaacaccaaatatggttgttgggata
ttaacaagaagaagtgtattaaatgcatataactcagatattactgctgatcaaattatt
aaatttttagaatcctattcacatcctggaaaaacaaaattaaaaagtataataccaatt
aatgttattactcagcttaaattatgggaagctgaaagacatcgattaacattagaagat
tctattgtttttaaaaatttcgaaaaagaatatttgccacatttatatcaacaaattgtt
atttgggctaatagcaaaaattatttattacattataccccttggccaaaaaatacaaat
tcccctgaatttgatgcatggatgaaaacagaaaaatatctatgttgcatatatgagtcg
aaaaatgaaattattgataagataaaggaaattcgtggtaagttaatgaaaaagcgtcaa
gcaatatga

DBGET integrated database retrieval system