KEGG   Plasmodium chabaudi: PCHAS_144090Help
Entry
PCHAS_144090      CDS       T01108                                 

Gene name
PC000323.01.0
Definition
(RefSeq) GTP cyclohydrolase I, putative
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pcb  Plasmodium chabaudi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCHAS_144090 (PC000323.01.0)
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PCHAS_144090 (PC000323.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 275 aa AA seqDB search
MDAYVEKKQVDEDYLLSIRKNETTNILEKNQPNNFSNDTTQSISLVHPKSVNNKNSDDKK
IGKGNKDNNNFIINDLEKQTNQISINILNILKASNIPDRDILKRTSNRFAKAFLYLTEGY
NMNVKNIIKKSIYKRKYKNNSLIKIKDIHVYSLCKHHLLPFEGLCDIEYNPDKYIMGLSK
FSRVTDIYARRLQLQEDLTNDICNALKKYLKPLYIKVTIKAKHLCINMRGVKEHDAMTVT
HASYVSKQGTNCFKEHINSSENEIPKLDTPEQALS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttatgtcgaaaaaaagcaagtcgatgaggattacctattaagtattcgaaaa
aatgaaacaacaaacattttagaaaaaaatcagccaaataacttttcaaatgatacaaca
caatcgataagtcttgttcatcctaaatccgtaaataacaaaaatagtgatgataaaaaa
ataggtaaaggcaataaggataataataattttattataaacgatttagaaaagcaaaca
aaccaaataagtatcaatatattaaacattttaaaagcatcaaatattccagatcgtgat
atattaaaaagaacaagcaacagatttgctaaagcatttttatatttaactgaaggatat
aatatgaatgtaaaaaatataataaaaaaatctatatataaaagaaaatataaaaataat
tcgttaattaaaataaaagatatacatgtttattccttatgtaaacatcatttattacca
tttgaaggattatgtgatattgaatataacccagataaatatataatgggtttgtcaaaa
ttttcgagagttactgatatatatgcacgtcgtttacaattacaagaagatcttactaac
gatatttgtaatgctttaaaaaagtatttaaaacccttatatataaaagtcacaattaaa
gcaaagcatttatgtattaatatgaggggagtaaaggaacatgatgctatgacagttaca
catgcatcatatgtatcaaaacaaggaaccaattgttttaaagaacatattaattcttcg
gaaaatgaaataccaaaattggatacccctgaacaagctttatcataa

DBGET integrated database retrieval system