KEGG   Plasmodium chabaudi: PCHAS_142240Help
Entry
PCHAS_142240      CDS       T01108                                 

Gene name
PC000354.03.0
Definition
(RefSeq) histone H2B variant, putative
  KO
K11252  
histone H2B
Organism
pcb  Plasmodium chabaudi
Brite
Chromosome [BR:pcb03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PCHAS_142240 (PC000354.03.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PCHAS_142240 (PC000354.03.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcacaaaaatcacaggctgcaaagaaaactgcaggaaaaacc
ttgggcccaaggcacaaaagaaaaagaagaacagaatctttttcactttacatttttaaa
gttttaaaacaagtccacccagaaacaggagtaacgaaaaaaagcatgaacattatgaat
tcatttatcaatgatatttttgacagattagtcactgaagcaactagattaattcgttac
aataaaaaaagaactttatcatcacgtgaaattcaaactgcagttagattacttttacct
ggtgaattatcaaaacacgctgtttcagaaggtaccaaagctgtaacaaaatacactacc
agtggtgcataa

DBGET integrated database retrieval system