KEGG   Plasmodium chabaudi: PC000354.03.0Help
Entry
PC000354.03.0     CDS       T01108                                 

Definition
histone h2b
Orthology
K11252  
histone H2B
Organism
pcb  Plasmodium chabaudi
Brite
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PC000354.03.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcacaaaaatcacaggctgcaaagaaaactgcaggaaaaacc
ttgggcccaaggcacaaaagaaaaagaagaacagaatctttttcactttacatttttaaa
gttttaaaacaagtccacccagaaacaggagtaacgaaaaaaagcatgaacattatgaat
tcatttatcaatgatatttttgacagattagtcactgaagcaactagattaattcgttac
aataaaaaaagaactttatcatcacgtgaaattcaaactgcagttagattacttttacct
ggtgaattatcaaaacacgctgtttcagaaggtaccaaagctgtaacaaaatacactacc
agtggtgcataa

DBGET integrated database retrieval system