KEGG   Plasmodium chabaudi: PC000358.03.0Help
Entry
PC000358.03.0     CDS       T01108                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pcb  Plasmodium chabaudi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pcb00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 181 aa AA seqDB search
MFGISASNFLISALVVATSIILVVWGKSKWNKKKELFMLYSKKHEYEEIDIKSKSDENKK
FLNGKSQTLKLNDIITLTDTVKIYIFSYPSEYDNFGLGICKHIKFNGLNIKGKIQGKWNN
NDDREKDLLEIYRSYTPVYINKKKKQVHFIIRIYKEDEHFIDGGKMSSHLDKLKTNNTIN
I
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaatttctgcatcgaattttttaatctcagcattagttgtagctacttctata
attttagttgtttgggggaagagtaaatggaataaaaagaaagaattatttatgttgtat
tcgaaaaaacatgaatatgaagaaatagatataaaatcgaaaagtgatgaaaataaaaaa
tttttaaatggaaaaagtcaaacattaaaattaaatgatataataacattaacagatact
gtaaaaatatatattttttcttacccaagtgaatatgacaattttggtttggggatatgt
aagcatataaaatttaatggcttaaatataaaagggaaaatacaagggaaatggaataac
aatgatgatagagaaaaagatttattagaaatttatagaagttatacacctgtatatata
aataaaaaaaaaaaacaagttcattttataattcgtatatataaagaagatgaacatttt
atagatggtggaaaaatgagctctcatcttgataaattgaaaactaataatacaataaat
ata

DBGET integrated database retrieval system