KEGG   Plasmodium chabaudi: PCHAS_020720Help
Entry
PCHAS_020720      CDS       T01108                                 

Gene name
PC000386.05.0
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 1, putative
  KO
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PCHAS_020720 (PC000386.05.0)
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PCHAS_020720 (PC000386.05.0)
Ubiquitin system [BR:pcb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PCHAS_020720 (PC000386.05.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2
AA seq 2921 aa AA seqDB search
MDKNKKKNKKLEIRDPSDEINNCEGEKGGTQFDESFPFDNPEPNHINENHNVNNDDQNHV
NIKKKNTSNSFENDILEFLPPNVDNNSDIFHANEVNKIEETNLNDNEQNTMNIKNKDPNN
RLDPKGNDDNIVKNVESDFEKNNNLLVTDENVNDHFENTNEQLNKNQDKDENIGKPNKRE
DSDEHESGRKKRSVKDNVYEDFIREYKNLQSLFSYNQTMIKESFNPMPTILEDDNNYSDK
NGSERNEDMKIPFDENVDKNATPRNHINPDYSAAYNLNDDAVISDVNKTSEKVSEEVHET
MDNKVDETDHPHFSNQLNYPTNNDVQEDENKSLLRERGNENDKENGVETQNNDTNLGEEK
EHMELKKEIKHKEFENQERKQNKEKEMNDASAPENEKNIDEISKKKENHYIQKKNTITQL
QEKKSSSNTSIASIINDNYDDHKISKKNNIEHVGKTQFSNDSIKKKHHPIDRNEYKSSSP
KNNRTNTEIKKGITESDNLKIKKIEKETDDPNLYINILDENSKDNKKKDLYLNNSFYLSK
QDRSSKIQSAKNVEEVNGKIKKVKKHQASSDESSEVNEMDHENYSKINKSLTEQHRKKDT
KKKKVEKKKKNNNNNTENTFDSKHLNDDNFSLSYFTEDKKEGYDSIHEAKEVLQEYVNGK
VKKHIRENKETNKYKNVDPTLVKKIKNITKHTDFNINNLDDQLCKLDPPIKHSKHHKETT
KKKSVRQSSSSVKKKHTKHSSKKNKKEDDPNDSDIKEWESKFIEEDEEEDEEYNDPYLTI
INEKQKKKESKHSKKKKIYMTNESFKNSISTVDDTQSGQEDDENDQAMQLSFFNFFDKQK
NNQHIVNLQKEDNEIEKDELNYKKKKKKKKDNRKTNDILKDDVKFEHNINNFFSSFWDNE
NLKKKNKDDLYNLNNENNKDIYSVNKIEKKINKPYLHISKEDNINEQIDRLRREIAQNNI
LTEHDKHIDERKGDIRKFLHWDDGKKGKHNGKDDKKEKDKLKEKDKIKYKEKMDYPNYEH
NRNYDEDKRKHKKNHMENYDESYNPYSIEEYNNYSSSENELKRIYNKNEKKYMDGILLNK
NYDEPINNSLKKKHHKHEDKENNYFLENNNDNSTAHNNNGYTTKGLGFFSSNFFHLKKLI
EKKNVENNDSLKRENGVDKFYEKNENNAKNEKKKLSSFDILQKFINNKGDTKYGKIDDSY
KRGNNDVAELYHISRRKGSINEYGDPHETAQISDGYSEKAGHNDIDEYTNFQTYRRNPDE
RDRRYYKDKREYHENEKHEKNSKHKKHAEYKWKKINKELINDHTDHIEDDEKSVKFRKKF
NYNLTRTGSNESMINEFGINKLNPQFSDEEKNENNNINKYDEKDDEIYENSENFLYSVDN
FKIVKNILLSLELTNDNKINKIRKILFYSSSEEKKKIMDEILNTLYIYPQLYVSCIICLF
YLFILDNDLFERKFSPEDLVYLFNDKIDFRYAEWFLKTYLFYKYKFSNSSNSDDEHKSYT
CDDELFDEPLKFKDASIGKDKAEKLKNEQLKNEKLKSEKNGDINSLISEKDDTRGNSTLD
GIEGNEKTKRKNKAKNIICDNFFESYNSSGDSMDNYVYCPNEKIEERNKNNESDKQSERK
IDEIWNKIESNKYVGYNECKMLLKICLTNENIQNIKMLSESKIRSLVISIWLNIRCSRPK
KYFLKLIYNWINNKNDDFNKKKNLFNLLKAEKKHNKNITKACFNYFLKFLIKYKENCSND
IIYTLYLIDEHELKLYSKKFIEKNQININQFISIWNIMCILFWDTKKIHNFTLSNKNTNN
YYYDFMLIFLKTFYEYIFTANSQFGQNIYLKRMSNTSGVSAISFPNRNYNKLSSKASSTY
AESQNKGNYNDESDDFNLFDVENIIKEFNFNDIVNAEVSSKNLMHSPRDHNHDSHGTHPS
ESIESAENREEIEQAKENTIGIKNMLKFIIQKSKKEKNMICCSDANELKLLVFLGICIKI
VICRISNLLNAKACLEQFYYFINHKILGLKIFRHSHIVLVYFIPFFKKYYFLWKFIEHEI
DPEIIKLINAIINNLENLQNNKNINNIGSNPMLHPYTRSNTSLPEVDHFSFPSKDKNLNH
TFNNFSTQYNPHDYKTSFSHSISIENNNSKQNFFKHKQNDLSLDSDLPTPDLFNPKNKKK
KKKNSEKFEDSHNKNQQHPHDYSEFDSHNNFHKNIINNINNINYFRPSSLFNTNENCDHG
ITYDDMFRDNDNSSDDNYFDKGKNKICNVKEYITNLHFNNLPDYPTSLKNSDENKKSEDK
KKKKKKIKNENQNSKEEQDNGEEENHSNKTQHKENNNISKVNEQNENILLYNIQDNENAE
NKISKNSNTTRKYMIDENLNEYKIENKKDVSNNYNNKEGSPTFEEDKYRHNNRSSTPQNN
GIKKFPTVSYEDADNSNNMVDKKSQKNYINLELDREKKENFGSSKKLTNIESAKGMNNDD
NYNSNNEILNNRRTIQTNGHTVNYNRNNNNMRPDEYENFVKDKKNDLDIIQRKGISLVNA
TTNNNYEEINIVNNPIEKNKHVSSDKLIQKRPKYLMLPIDTTELKKMQKGKLRHPPVGLI
NLGNTCYLNSLLQALYSTVSFVVNLYIFNIDDNKELKHINNKNISNEMPIKNKLSFNLNN
TNMNNNNNNANLLSKRFLYELKILFKLMTTTNKKYVSPDNILGILPQELNNRNQQDVTEL
FRYTFEQLGGSEKKFLRLIFSGVVIQKVQCQKCFFISKKEEIIHDLSFHVPAKSSKKQSI
QKFFDTYIQKEKIYGNNKYKCSKCNKRRNALKWNEIISPPCHLILILNRYNWSFSSNEKK
KIKTHVKINKKIVVNNFDYRLYGGIIHSGVSASSGHYYFIGKKSEKGDNSKNEWYQMDDS
AITKVSSKSINRISKDPSNDHTPYVLFYRCKQAPDSPSLYF
NT seq 8766 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaacaaaaagaaaaacaaaaaactagaaattagagaccctagtgatgaaatt
aataattgtgaaggggaaaaggggggcacacaatttgatgagtcatttccatttgataat
ccagaacctaatcatataaatgaaaatcacaatgttaataatgatgaccaaaatcatgtt
aatataaaaaaaaaaaatactagtaactcttttgaaaatgatatacttgaatttttgcca
ccaaatgtggataataattcagatatttttcatgcaaatgaagttaataaaatagaagaa
actaatttaaatgacaatgaacaaaatacaatgaatataaaaaataaagatcctaataat
cgtcttgatcccaaagggaatgatgataatattgtaaaaaatgtcgaaagtgattttgaa
aaaaataataatttattagttacagatgaaaatgttaatgatcattttgaaaacactaat
gaacagttaaataaaaatcaagataaagatgaaaatattgggaagccaaataaaagggag
gacagtgatgaacatgagagtggtagaaagaaaagatccgtcaaagataatgtctatgaa
gattttataagggaatataaaaatttacaatccctattttcatataatcaaactatgata
aaagaaagtttcaatccaatgccgaccattttggaagacgataataattatagcgataaa
aatggaagcgaacgcaatgaagacatgaaaattccctttgatgaaaatgtagataaaaat
gcaacaccacgtaatcatataaatcccgattattcagctgcatataatttaaacgatgat
gcagttatatcggatgtaaacaagactagcgaaaaggttagcgaagaagtacatgaaaca
atggataacaaagtagacgaaaccgatcatccacatttctcaaaccagttaaattaccca
accaataatgatgttcaagaagatgaaaataaaagccttttgcgtgagaggggaaatgaa
aatgataaagaaaacggagtagaaacccaaaataatgatactaatttgggtgaggagaag
gaacatatggaattaaaaaaagagattaaacataaagaattcgaaaatcaagaaaggaaa
caaaataaagaaaaagaaatgaatgatgctagtgccccagaaaatgaaaaaaatatcgat
gagatttctaaaaaaaaagaaaatcattatatacaaaaaaaaaatacaatcacacaacta
caagaaaaaaaatcaagtagcaacacaagtatagccagcataattaatgacaattatgat
gatcataaaatttcaaaaaaaaataatatcgaacacgttggtaaaactcagttttccaat
gattcaataaaaaaaaaacatcacccaattgatcgtaatgaatataaaagtagttctccc
aaaaataatcgaacaaatacagaaattaaaaaaggcataactgaatcagataatttaaaa
ataaaaaaaatagaaaaagaaacggatgatccaaatttgtatataaacattttagatgaa
aatagtaaagataataaaaaaaaggacttatatttaaataattcattttatttgtcaaag
caggatcgtagtagtaagatacagagtgctaagaatgtggaagaggtaaatggaaagata
aaaaaagttaagaagcatcaagctagctctgatgaaagtagtgaagttaacgaaatggat
catgaaaattacagtaaaataaataaaagcttaaccgaacaacatcgaaaaaaagatact
aaaaaaaaaaaggtggaaaagaaaaaaaaaaataataataataatactgaaaatacattt
gattcaaaacatttaaacgatgacaattttagtctttcgtattttaccgaagataaaaaa
gaaggttatgattcaattcatgaagccaaagaagtgctccaagaatatgtaaatggaaag
gttaagaagcatatacgagaaaataaagaaacaaataaatataaaaatgtcgatcctaca
ttggtgaaaaaaataaaaaatataacaaaacatacagactttaatataaataatttagat
gatcaactatgtaaattagatccaccaataaaacatagcaagcatcataaagagacaacg
aaaaaaaaatcagtaagacaaagttcaagctcagttaaaaaaaaacatactaagcatagt
agcaaaaaaaacaaaaaagaagacgatccaaatgatagtgatataaaagaatgggaatca
aaatttattgaagaagacgaagaagaagatgaagaatataatgatccatatttgacaatt
ataaatgaaaaacagaaaaaaaaagaaagtaaacattcaaagaaaaaaaaaatatatatg
acaaatgaaagttttaaaaattcaatttctacagtagatgacactcaaagtggacaagaa
gacgatgaaaatgatcaagctatgcaacttagtttttttaatttctttgataaacaaaaa
aataatcaacatatagtaaatttacaaaaggaagataatgaaatcgaaaaagatgaatta
aattataaaaaaaaaaaaaaaaaaaaaaaagataatcgaaaaacaaatgatatattaaaa
gatgatgttaaatttgaacataatataaataacttttttagttcgttttgggataatgaa
aatttaaaaaaaaaaaataaagacgatttatataaccttaataatgaaaataataaagat
atatattcagttaataaaatagaaaaaaaaataaataaaccatatcttcatatttcaaaa
gaagataacataaacgaacaaatagatagattaaggagagagatagctcaaaataatatt
ttaacagaacatgataaacatatcgatgaaagaaaaggtgatattagaaagttccttcat
tgggatgatggaaaaaaaggaaaacataatggaaaagatgataaaaaagaaaaagataaa
cttaaagaaaaagataaaataaaatataaagaaaaaatggattaccccaattatgaacat
aatagaaattatgatgaagataaacgtaaacataaaaaaaatcatatggaaaattatgat
gaatcatataatccttattcgatcgaagaatataataactatagtagtagtgaaaatgag
ttaaaacgaatttataataaaaatgaaaaaaaatatatggatggaattcttttaaataaa
aattatgatgaaccaataaataatagtttaaaaaaaaaacatcataagcatgaagataaa
gaaaataattattttttagaaaataataatgataactctactgcacataataataatggc
tacactacaaaaggtcttggatttttttcaagtaatttttttcatttaaaaaagttaata
gaaaaaaagaatgtcgaaaataatgattcgttaaaaagggaaaatggggtagataaattt
tatgaaaaaaatgaaaataatgcaaaaaatgaaaaaaaaaaattaagctcttttgatata
ttgcaaaaatttataaataataagggagatacaaaatatggaaaaattgatgattcttat
aaaagaggaaataacgatgttgcagaactttatcatatttcaagaagaaaaggaagtata
aatgaatatggagatcctcatgaaacagcacaaataagtgatgggtatagtgaaaaggca
ggacataacgacatagatgaatatacaaattttcaaacatatagaagaaatccagatgaa
agagatcgaagatattataaagacaaacgtgaatatcatgaaaatgaaaaacatgaaaaa
aatagtaaacataaaaaacatgctgaatataaatggaaaaaaataaataaagaattaata
aatgatcatacagatcatattgaagatgatgaaaaatctgtaaaatttcgaaaaaaattt
aattataatttaactagaacaggatcaaatgaaagtatgataaatgaatttggaataaac
aaattaaacccacaatttagtgatgaagaaaaaaatgaaaataacaacataaataaatat
gatgaaaaagatgatgagatttatgaaaatagtgaaaactttttatattctgttgacaat
tttaaaattgttaaaaatattctactatctttagaattaacaaatgataataaaattaat
aaaattcgaaaaatattattttattcctctagtgaagaaaaaaaaaaaatcatggatgaa
attttaaatacactttatatatacccacaattatatgtatcttgtattatttgcttgttt
tatttatttatattagataatgatttatttgaaagaaaattctcacccgaagatctcgtc
tacttatttaatgacaaaatagattttcgttatgccgaatggtttttaaaaacatatcta
ttttacaaatataaattttcaaactcttcaaattcagatgatgaacataaaagttatact
tgtgacgatgaactttttgacgagcctctcaaatttaaagatgcttcgattggaaaggat
aaggcagaaaaattgaaaaacgaacaattgaaaaatgaaaaattgaaaagcgaaaaaaac
ggagatataaacagcttaattagcgaaaaagatgacacacgtggtaattcaactttagat
ggtatagaaggaaatgaaaagacaaaaagaaaaaacaaagcaaaaaatattatatgtgat
aatttttttgaatcatataattcaagtggagattcaatggataattatgtttattgtcca
aatgaaaaaatagaagaacgaaataaaaataacgaatcagataaacaatcagaaagaaaa
atagatgagatttggaataaaattgaaagtaataaatatgtaggatataatgaatgtaaa
atgttattaaaaatatgtttaacgaatgaaaatattcaaaatattaaaatgctatctgaa
agtaaaataagaagcttagttatttctatctggttaaatatccgttgttctagacccaaa
aaatatttcttaaaattaatttataattggataaataataaaaatgatgattttaataaa
aaaaaaaatttatttaatttgcttaaagcagaaaaaaaacataataaaaatataacaaaa
gcatgttttaattattttttaaaatttttaataaaatataaagaaaactgttcgaatgat
attatatatactttatatttaatagacgaacatgaattaaaattatattcaaaaaaattt
attgaaaaaaatcaaattaatattaatcagtttatatctatatggaatataatgtgcata
ttattttgggacacaaagaaaatacataatttcactttatcaaacaagaatactaataat
tattattacgattttatgcttatatttttaaaaacattttatgaatatatatttacagct
aattctcaatttggtcaaaatatttatcttaaaaggatgagtaatactagtggtgtttct
gcaataagtttcccaaacagaaattataataaactttcatccaaagcttcttcaacatat
gctgaatcacaaaacaaaggtaattacaatgatgaatctgatgatttcaatctttttgat
gttgaaaatattatcaaagagttcaattttaatgatattgttaatgctgaggtgagttca
aaaaacctaatgcactcccctcgcgatcacaatcacgattcccacggaacccacccctcc
gaatccattgaatcagcagaaaaccgagaggaaatcgaacaggccaaggaaaacacgatc
ggaataaaaaatatgcttaagttcataatccaaaaaagcaaaaaggaaaaaaatatgata
tgttgtagtgatgctaatgaactgaaactgttggtatttttaggcatatgtataaaaatt
gtcatatgtaggatatcaaatttattaaatgcaaaagcatgcttagaacaattttactat
ttcataaatcataaaatattgggtttaaaaatatttcgacattctcatatcgttttagtt
tattttattccgtttttcaaaaaatattattttttatggaagtttattgaacatgaaatt
gatccagaaattattaaactcataaatgcaattataaataatttagaaaacttacaaaat
aataaaaatataaataatattggaagtaatcctatgttacatccatacactcgtagtaat
acatcattacctgaagtagatcatttctctttcccttcaaaagataagaatctaaatcat
acttttaataatttttctacccaatataacccacatgattataaaacaagcttctctcac
agcatatcaatagaaaataacaattcaaaacaaaacttttttaaacataaacagaatgat
ttatcattagattctgatttgccaacaccagatttatttaacccaaaaaataaaaaaaaa
aaaaaaaaaaattctgaaaaatttgaagattcacataataaaaatcagcaacatcctcat
gattattccgaatttgattcacataataattttcacaaaaatataattaataatattaat
aatattaattattttagacctagctctttatttaatacaaatgaaaattgtgatcacggt
attacttatgatgacatgtttagagataatgacaatagcagtgatgataattattttgat
aaaggtaaaaataaaatttgtaatgttaaagaatatattacaaacttacattttaataat
ttaccggactatcctacttctttgaaaaatagtgatgaaaataaaaaatcggaagataaa
aaaaaaaaaaaaaaaaaaataaaaaatgaaaatcaaaatagtaaagaagaacaagataat
ggggaagaagaaaatcatagtaataaaactcaacataaagaaaataataatatttcaaaa
gtcaatgagcaaaatgaaaatattttactttataatatacaagataatgaaaatgcagaa
aacaaaatatccaaaaattctaacactactcgaaaatatatgattgatgaaaaccttaat
gaatataaaattgaaaacaaaaaagatgtatcaaacaattataataataaagaaggatca
ccaacttttgaagaagataagtatagacataataatcgatcaagcactcctcaaaacaat
ggaattaaaaaatttcctactgtttcctatgaagatgctgataattcaaataatatggtg
gataaaaaatcacaaaagaattatataaatttagaattagatagagagaaaaaagaaaat
tttggatcctcaaaaaagttaactaacattgaaagtgctaaaggaatgaataatgatgac
aattataatagcaataatgaaatattaaataatcgtagaacaattcaaaccaatggacat
actgttaactacaacagaaataataacaatatgagaccagatgaatatgaaaactttgta
aaagataaaaaaaacgatttagatattatacaaagaaaaggaatatctcttgttaatgct
acaacaaataataattatgaagaaataaatatagttaataatcctatagaaaaaaataaa
catgttagttcagataagttaatacaaaaacgacccaaatatttaatgttaccaattgat
acgactgaattaaaaaaaatgcaaaaaggaaaattacgacacccacctgttggtttgata
aatttaggaaatacttgctacttaaatagtttattacaagcattatatagtactgtttca
tttgttgttaatttatacatttttaatattgatgataataaagaattaaaacacataaat
aataaaaatatctctaacgaaatgcccatcaaaaataaattatcatttaacctgaacaat
acaaacatgaataataataataataatgcaaacttactttcaaaacgatttttatatgag
ttgaaaatattatttaaattaatgactacaacaaataaaaaatatgtttcaccagataat
attttaggtatactacctcaagaacttaacaatagaaatcaacaagatgttacagaatta
tttagatatacatttgaacaattaggaggatcagaaaaaaaatttctaagattaatattt
tcaggagttgttatacaaaaagttcaatgccaaaaatgtttttttatttcaaagaaagaa
gaaattatccacgatttatcatttcatgttcctgcaaagtcaagtaaaaaacagtctatc
caaaaattctttgatacatatattcaaaaagaaaaaatttatggaaacaataaatacaaa
tgctcgaaatgcaacaaaaggcgaaatgccctcaagtggaacgaaatcatatcccccccc
tgccacctcatactaattctgaacaggtacaactggtcgtttagctccaacgaaaagaag
aaaataaaaacgcacgtcaagatcaacaaaaagatagttgtaaacaattttgattaccga
ttgtatggaggaataattcacagtggcgtgtcagcatcatcaggtcattattattttatc
ggaaagaaatccgaaaaaggtgacaattcaaaaaatgaatggtatcaaatggacgactca
gctattactaaagttagttccaaatccataaaccgaatttctaaagatccatcaaatgat
cacactccttacgttttattttatcgttgcaaacaagctcccgattccccaagcttatac
ttttaa

DBGET integrated database retrieval system