KEGG   Plasmodium chabaudi: PC000386.05.0Help
Entry
PC000386.05.0     CDS       T01108                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PC000386.05.0
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PC000386.05.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 256 aa AA seqDB search
KYLMLPIDTTELKKMQKGKLRHPPVGLINLGNTCYLNSLLQALYSTVSFVVNLYIFNIDD
NKELKHINNKNISNEMPIKNKLSFNLNNTNMNNNNNNANLLSKRFLYELKILFKLMTTTN
KKYVSPDNILGILPQELNNRNQQDVTELFRYTFEQLGGSEKKFLRLIFSGVVIQKVQCQK
CFFISKKEEIIHDLSFHVPAKSSKKQSIQKFFDTYIQKEKIYGNNKYKCSKCNKRRNALK
WNEIISPPCHLILILN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
aaatatttaatgttaccaattgatacgactgaattaaaaaaaatgcaaaaaggaaaatta
cgacacccacctgttggtttgataaatttaggaaatacttgctacttaaatagtttatta
caagcattatatagtactgtttcatttgttgttaatttatacatttttaatattgatgat
aataaagaattaaaacacataaataataaaaatatctctaacgaaatgcccatcaaaaat
aaattatcatttaacctgaacaatacaaacatgaataataataataataatgcaaactta
ctttcaaaacgatttttatatgagttgaaaatattatttaaattaatgactacaacaaat
aaaaaatatgtttcaccagataatattttaggtatactacctcaagaacttaacaataga
aatcaacaagatgttacagaattatttagatatacatttgaacaattaggaggatcagaa
aaaaaatttctaagattaatattttcaggagttgttatacaaaaagttcaatgccaaaaa
tgtttttttatttcaaagaaagaagaaattatccacgatttatcatttcatgttcctgca
aagtcaagtaaaaaacagtctatccaaaaattctttgatacatatattcaaaaagaaaaa
atttatggaaacaataaatacaaatgctcgaaatgcaacaaaaggcgaaatgccctcaag
tggaacgaaatcatatcccccccctgccacctcatactaattctgaac

DBGET integrated database retrieval system