KEGG   Plasmodium chabaudi: PCHAS_090860Help
Entry
PCHAS_090860      CDS       T01108                                 

Gene name
PC000538.04.0
Definition
(RefSeq) conserved Plasmodium protein, unknown function
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PCHAS_090860 (PC000538.04.0)
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C86
   PCHAS_090860 (PC000538.04.0)
Ubiquitin system [BR:pcb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    PCHAS_090860 (PC000538.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 232 aa AA seqDB search
MCRYGIHKIETEKGPINVYFEKQSKLYCLVHTINNILQAHVYSPQDFREFENNFDYTNLN
NNTSDDNNTINENNNKSADLNIKDTLNFENIFSYIKRGINYFGNFNIDVLYFFVSKHNIE
LNWVDNKEIFKKVNQNSDCLSLFSDSVLNDPKLIAFVINLVKINFINIYKHRHFYTIRKI
SGMWFVLDSSHSKPVLLPTSQEINKHLINIVKDNNFTNRDNYIIQVFKNYEK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgctatggaatacataaaattgaaacggaaaagggaccaataaatgtatacttt
gaaaaacaaagtaaattatattgcttagttcatactataaataatatattgcaggcgcat
gtatattctccccaagattttagagaatttgaaaacaactttgattatacaaacctaaat
aataacacatcagacgataataataccataaatgaaaacaataataaatctgctgaccta
aatataaaagacacactgaactttgaaaacattttttcctatattaaaagaggaattaat
tattttggaaattttaatattgatgttttatatttttttgtgagcaaacataatattgaa
ttgaattgggttgacaataaagaaatatttaaaaaggtaaatcaaaatagtgattgtctt
tctctatttagtgatagcgttttaaatgacccaaagctaattgcttttgtaataaacttg
gttaaaataaattttataaatatttacaagcatagacatttttatacaataagaaaaatt
tcaggcatgtggttcgtgctggattcctcacacagcaagcctgttttgttacctactagc
caagaaataaacaaacatttaattaatatagtaaaagataataatttcactaatcgtgat
aattatattatacaagtttttaaaaattatgagaaataa

DBGET integrated database retrieval system