KEGG   Plasmodium chabaudi: PCHAS_090860Help
Entry
PCHAS_090860      CDS       T01108                                 

Gene name
PC000538.04.0
Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pcb  Plasmodium chabaudi
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 232 aa AA seqDB search
MCRYGIHKIETEKGPINVYFEKQSKLYCLVHTINNILQAHVYSPQDFREFENNFDYTNLN
NNTSDDNNTINENNNKSADLNIKDTLNFENIFSYIKRGINYFGNFNIDVLYFFVSKHNIE
LNWVDNKEIFKKVNQNSDCLSLFSDSVLNDPKLIAFVINLVKINFINIYKHRHFYTIRKI
SGMWFVLDSSHSKPVLLPTSQEINKHLINIVKDNNFTNRDNYIIQVFKNYEK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgctatggaatacataaaattgaaacggaaaagggaccaataaatgtatacttt
gaaaaacaaagtaaattatattgcttagttcatactataaataatatattgcaggcgcat
gtatattctccccaagattttagagaatttgaaaacaactttgattatacaaacctaaat
aataacacatcagacgataataataccataaatgaaaacaataataaatctgctgaccta
aatataaaagacacactgaactttgaaaacattttttcctatattaaaagaggaattaat
tattttggaaattttaatattgatgttttatatttttttgtgagcaaacataatattgaa
ttgaattgggttgacaataaagaaatatttaaaaaggtaaatcaaaatagtgattgtctt
tctctatttagtgatagcgttttaaatgacccaaagctaattgcttttgtaataaacttg
gttaaaataaattttataaatatttacaagcatagacatttttatacaataagaaaaatt
tcaggcatgtggttcgtgctggattcctcacacagcaagcctgttttgttacctactagc
caagaaataaacaaacatttaattaatatagtaaaagataataatttcactaatcgtgat
aattatattatacaagtttttaaaaattatgagaaataa

DBGET integrated database retrieval system