KEGG   Plasmodium chabaudi: PC000538.04.0Help
Entry
PC000538.04.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MCRYGIHKIETEKGPINVYFEKQSKLYCLVHTINNILQAHVYSPQDFREFENNFDYTNLN
NNTSDDNNTINENNNKSADLNIKDTLNFENIFSYIKRGINYFGNFNIDVLYFFVSKHNIE
LNWVDNKEIFKKVNQNSDCLSLFSDSVLNDPKLIAFVINLVKINFINIYKHRHFYTIRKI
SGMWFVLDSSHSKPVLLPTSQEVNIEKNNKIKKMHNIYTNVT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgctatggaatacataaaattgaaacggaaaagggaccaataaatgtatacttt
gaaaaacaaagtaaattatattgcttagttcatactataaataatatattgcaggcgcat
gtatattctccccaagattttagagaatttgaaaacaactttgattatacaaacctaaat
aataacacatcagacgataataataccataaatgaaaacaataataaatctgctgaccta
aatataaaagacacactgaactttgaaaacattttttcctatattaaaagaggaattaat
tattttggaaattttaatattgatgttttatatttttttgtgagcaaacataatattgaa
ttgaattgggttgacaataaagaaatatttaaaaaggtaaatcaaaatagtgattgtctt
tctctatttagtgatagcgttttaaatgacccaaagctaattgcttttgtaataaacttg
gttaaaataaattttataaatatttacaagcatagacatttttatacaataagaaaaatt
tcaggcatgtggttcgtgctggattcctcacacagcaagcctgttttgttacctactagc
caagaagtaaatatcgaaaaaaataataaaataaaaaaaatgcataatatatatactaat
gtgacataa

DBGET integrated database retrieval system