KEGG   Plasmodium chabaudi: PC000605.02.0Help
Entry
PC000605.02.0     CDS       T01108                                 

Definition
biotin carboxylase subunit of acetyl CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pcb  Plasmodium chabaudi
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PC000605.02.0
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PC000605.02.0
   00640 Propanoate metabolism
    PC000605.02.0
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PC000605.02.0
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PC000605.02.0
Enzymes [BR:pcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PC000605.02.0
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PC000605.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1555 aa AA seqDB search
LNEKFNSVKKYLTNLNLSITNTINKMSSSSNEELINDNSENNLSTTNTMHNDSVGNSGSN
DSLVSQRTNNISEERIDNSDNFISYDSYKNQSYKDKKVSTEIDAELNFDNRKDKGNEFFL
ELSNTKRIEYLLKGYEQDYEKCFENFLKDKNNFDTNLNYILDKFIEYNHLFSKKEIISEV
EIYSILYNSISDKKKQCEVIHAYTYNYLSIKFLEKILNNLINSKKMDLSLQILNKIKILK
EFKGKIFGSIILLSRYIIYLYEQIEKIHYLESSFQYNKNMEDMKKQSLQNYIRLLTKSKN
MDNYKIDKILNNTNCEEKIKFFLKSPLDIHNFLPFLFKTENYNYQEMLNTYLSNLYKYST
IKAKSHSSNCLIFSVNNHEYNNVMLNLNQDITIEQFKSMMDDILYETKSDMINTLHIINK
NETFFNSLQNYLDIAAKKVNTLYIYNYFGNKYSEIHKIDMNTYKERQKVQDNHETNKNDS
TINSKIYLLPFEEEILTSEDIAANFELKNVGQEIFNKTKISLGIYKQNNKYTSLFAQRII
DINDLQKQADSGNAKMHDEHKQIEMTPNGKNNILLSKNIEKGQINNQIYDLFMSELKESI
EDISTYRLNPSIQDIKITSNIIYHIVLPNNSNIEDQINGIKQIYKNFLNKYNELFIDNYV
NNVYIKVYAEIKDKTNNETKLELNQLLKLHVLFDNEKEVIEQVDKINPVLIDTLYLKRKR
ARDVDTTYAYDFVKLINIALNRINNTLNDNFNYINSVKEFKLDYSMEKSEETNDAISAGK
KEKSQPNKNDKQSKWLFENFDNLSNDEIRIKKSLYLSNSLEIGQNKLSVIGLLMNVKTDE
YKEGRDIVFIINDITTNGGAFSVLEDELFYGVSCYAREKKIPRICISCNSGAKIGLYNHL
MDKIKVCWNDENKKELGYKYLYITEEIKEQIPKKDIIYLREIYENGEKRYIIDAIVGNLN
NHIGVENLRGSGLIAGETSKAYDEIFTLSYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLT
GFNALNKILGEKVYISNEQLGGVNIMMKNGISQLEAENDQDGVDKIFKWLSYVPKTSDNY
FDVLREPTKLTHNKFQENSKPGFSKSKNINNSIDSDQESDNYPKGYTNDEDIQKYAQKNS
LHSSSDSTTFEPESVKESDTSLMHINEKNYDEESANEISDVIPDNWNQINDIDMDNVNEA
DIIELLKGSDKKQGFLDKNSYFEYMNEWGKGIITGRGKLGSIPIGFIAVNKNLVTQTVPC
DPALKTKAIKTTNAPCVFVPDNSYKTAQSIEDFNKENLPLFVFANWRGFSGGTMDMFNSI
LKFGSMIVNQLVNYKHPVFVYIPILGELRGGSWVVVDETLNSQIIEMYADTNSKGGILEP
PGLVEVKFKFSEIKKLMNNSDPYIIELNQKLATLQNEEEILSVKKEIEKKEKEMLPFYLQ
VCHKYADLHDVSSCMKEKGVIRKIVPWEKSRSFFYYLLRRLILHTLNKKFGDSYAKSDEI
KNIIDDLKNSESDDQVVCKRVLTGNVLKNINKINDEILHKKTLDGIFKEFQNLSK
NT seq 4665 nt NT seq  +upstreamnt  +downstreamnt
ttaaatgaaaaatttaattctgttaaaaaatatttaacgaatttaaatttatcgataaca
aataccataaataaaatgagttcatcatctaatgaagaattaataaatgataattctgaa
aataatttatctactacaaatacaatgcataatgattcagttggtaattctggtagcaat
gactcgcttgttagtcaaagaacaaataatatatcagaagaaagaatagataatagtgac
aattttatatcttatgacagttataagaatcaatcatataaagacaaaaaagtttctact
gaaattgatgctgaattaaattttgataaccgaaaagataaaggaaatgaatttttcctt
gaattatcaaacacaaaaagaattgaatatttactaaaaggatatgagcaagattatgaa
aaatgctttgaaaatttcttaaaagacaaaaataattttgatacaaatctaaattatata
ttagataaatttatagaatataatcatttattttcgaaaaaggaaattattagcgaagta
gaaatttattctattttatataacagtattagtgataagaaaaagcaatgtgaagttata
catgcatatacatacaactatttaagtataaaatttctagaaaaaatattaaataattta
ataaatagtaaaaaaatggatttatctttacaaattttaaataaaatcaaaatattaaaa
gaattcaaaggaaagatttttggatctataattttactatcgagatacattatatactta
tatgaacagatcgaaaaaattcattatttggaatcttcttttcaatataataaaaatatg
gaagatatgaagaagcaaagtttacaaaattatatccgtcttcttactaagtctaaaaat
atggataattataaaatagataaaatcttaaataatacaaattgtgaagaaaagataaaa
ttctttttaaaatcaccattggatattcacaattttttaccatttttatttaaaacggaa
aattataactatcaggaaatgcttaatacatatttaagtaatttgtacaaatactctact
ataaaagctaagtcacattcatccaattgtttaatattttctgtaaacaatcatgaatat
aacaacgtaatgttaaatttaaatcaagacatcactattgaacagtttaaaagtatgatg
gatgatatattatatgaaacgaaatctgatatgataaatacgttgcatataataaataaa
aatgaaactttctttaactcactgcaaaactatttagatatagctgccaaaaaagtgaat
actttatatatatataactattttggaaataaatatagtgagattcataaaattgatatg
aacacatataaagaacgacaaaaggtgcaagacaatcatgaaacaaataaaaatgattct
actataaatagtaaaatatatctccttccttttgaagaagaaattcttacttcagaggat
attgcagcaaattttgaattaaaaaatgtaggacaagaaatatttaataagactaaaata
tcgctaggaatatacaagcaaaataataaatacacttcgttatttgctcaaagaatcatc
gatataaatgatttacaaaaacaagctgattcaggcaatgcaaagatgcatgatgaacac
aagcaaattgaaatgactccaaatggaaaaaacaatatactattgtcaaaaaatatagaa
aagggccaaataaacaatcaaatttatgatttatttatgtctgaattaaaggaatctata
gaagatataagcacttatagattaaatccatcaattcaggatattaaaattactagcaat
ataatatatcatatagtattgcctaataattcgaatatagaagatcaaataaatggaatt
aaacaaatttataaaaatttcctcaataaatataatgagcttttcatagataactatgtt
aataatgtatatattaaagtatatgcagaaattaaagacaaaacaaataatgaaacaaaa
ttagagcttaatcaattgttgaaattacatgttctttttgataatgaaaaagaggttatt
gaacaagtagataaaataaatccagttcttatcgatacattgtacttaaaacgaaagagg
gcaagagatgtagatactacatatgcttatgattttgttaagcttataaacattgcatta
aataggataaataatactttgaatgacaattttaattatattaatagtgtgaaagaattc
aagttagattatagtatggaaaaatccgaagaaacaaacgatgcaataagtgcaggcaag
aaagaaaaatctcaacctaataaaaatgataagcaatctaaatggctttttgaaaatttt
gataatttaagtaatgatgaaattcgaataaaaaaatccctttatttatcaaactctttg
gaaataggacaaaataaactaagtgtaatcggattgttaatgaatgtaaagacagatgaa
tataaagaaggaagagatattgtttttataataaatgacattacaacaaatggaggtgca
tttagtgttttagaagatgaattattttatggagtatcatgttatgcaagagaaaaaaag
ataccacgtatatgtatatcttgcaactcaggagcaaaaataggattatataatcatctt
atggataaaattaaagtatgttggaatgatgaaaataaaaaagaacttggatataaatat
ttatatataacagaagaaataaaagaacaaattcctaaaaaagatattatttatttaaga
gaaatttatgaaaatggagaaaaaagatatataattgatgctattgtaggaaatttaaat
aatcatataggggtagaaaacttacgaggtagtggattaatagcaggagaaacctcaaaa
gcttatgacgagatttttactctttcatatgtcactggaagaagtgttggaattggtgct
tacttagttcgattaggtaaacgaactattcaaaaaaaaggatcgtctcttttactaact
ggttttaatgctttaaataaaatattaggtgaaaaagtatacataagtaatgaacaatta
ggaggtgtaaatattatgatgaaaaatggaatatctcaattagaagctgaaaatgatcag
gatggagtggataagattttcaaatggttgtcatatgttcctaaaacaagcgacaattat
tttgatgttcttagggaacctacaaaattaactcataataaatttcaagaaaatagcaaa
cctggttttagcaaatctaaaaacataaacaattcaattgattctgatcaagaatctgat
aattatccaaagggatacactaatgatgaagacatacaaaagtatgcgcaaaaaaacagt
ttacacagcagttcagatagtactactttcgagccagaaagtgtgaaagaaagtgatact
tccctcatgcacatcaatgaaaaaaattatgatgaagaatcagcgaacgaaattagtgac
gtgatcccagataattggaaccaaataaatgatatagatatggacaatgtaaatgaagca
gatattatcgaattactaaaaggatcagataagaaacaaggatttttagacaaaaacagt
tactttgaatatatgaatgaatggggaaaaggtattataactggaagaggaaaattagga
tcaataccaattggttttattgctgtaaataaaaatttagttacccaaactgttccatgt
gatccagcattaaaaactaaagctataaaaacaacaaatgctccttgtgtttttgtccct
gataattcatataaaactgcgcaatctattgaagattttaataaagagaatttgccttta
tttgtctttgcaaattggagaggattttcaggaggtactatggatatgtttaacagtatc
ttaaaatttggatcgatgatagttaatcaattagttaattataaacatcctgtttttgta
tacatacccattttgggagaacttagaggtgggtcttgggtagtagtagatgaaacattg
aacagccaaataatagaaatgtatgcagatactaatagtaaaggtggaatattagaacct
ccaggattagtagaagtaaaatttaagttctcagaaataaaaaagttaatgaataacagt
gatccatatataatagaactaaatcagaagcttgcgactcttcagaatgaagaagagatt
ttaagtgtaaaaaaggaaatagaaaagaaggaaaaggaaatgcttccattttatttacaa
gtgtgtcataaatatgcagatctacatgatgtatcctcatgtatgaaggagaaaggagtt
attagaaagattgttccatgggaaaaatctcgatcctttttctattacttattaagaaga
ttgatattgcatacattaaacaaaaaatttggagattcttatgcaaaatctgatgaaatt
aagaatattatcgacgaccttaaaaattcggaaagtgatgaccaagttgtatgcaaaaga
gttttaactggaaatgttttaaaaaatataaacaagataaacgatgaaattttacataaa
aaaactttagatggtattttcaaagaatttcaaaatttatcaaaa

DBGET integrated database retrieval system