KEGG   Plasmodium chabaudi: PCHAS_061220Help
Entry
PCHAS_061220      CDS       T01108                                 

Gene name
PC000699.01.0
Definition
(RefSeq) glutathione peroxidase-like thioredoxin peroxidase, putative
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pcb  Plasmodium chabaudi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PCHAS_061220 (PC000699.01.0)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCHAS_061220 (PC000699.01.0)
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PCHAS_061220 (PC000699.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 200 aa AA seqDB search
MRILLIIKLCILFLIAGENFITMFPFFKKITVLKTELKPSLYDYNVKSLNGTDVPMSNYK
NKVLIIFNSASKCGLTKNHVNQFNELHEKFNDKGLEILGFPTYQFFSQEFKQSCDISQFN
QEKNIKYHVFAPVEVNGENTHELFKYLKFNCNEMHDENGVLENIGWNFGKFLVDKNGNVV
KYYSPKLSPMYMEKDITDLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatattattaataattaaattatgtatattatttttaattgccggtgaaaatttt
atcacaatgtttcccttttttaaaaaaataacggtattaaaaacggagttgaagccatct
ctatatgactataatgtaaagtcattaaatggaaccgatgtaccaatgtcaaactacaaa
aacaaagtcttaattatttttaattccgcatcaaagtgtggattaactaaaaatcatgtt
aatcaatttaatgaattacatgaaaaattcaatgataaaggattagagattttgggcttc
cctacatatcagttttttagccaagaatttaaacaaagttgcgatatcagccaatttaat
caagagaaaaatataaaataccatgtctttgctcctgttgaagttaatggggaaaatacc
cacgaactttttaagtaccttaaatttaactgcaacgagatgcatgatgaaaacggtgta
ctagaaaacatcggatggaactttggaaaattcttagtagacaaaaatggaaatgtagtt
aagtattattctccaaaacttagcccaatgtatatggaaaaagatattaccgatttatta
taa

DBGET integrated database retrieval system