KEGG   Plasmodium chabaudi: PC000699.01.0Help
Entry
PC000699.01.0     CDS       T01108                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pcb  Plasmodium chabaudi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PC000699.01.0
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PC000699.01.0
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PC000699.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 201 aa AA seqDB search
TMRILLIIKLCILFLIAGENFITMFPFFKKITVLKTELKPSLYDYNVKSLNGTDVPMSNY
KNKVLIIFNSASKCGLTKNHVNQFNELHEKFNDKGLEILGFPTYQFFSQEFKQSCDISQF
NQEKNIKYHVFAPVEVNGENTHELFKYLKFNCNEMHDENGVLENIGWNFGKFLVDKNGNV
VKYYSPKLSPMYMEKDITDLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
acaatgcgaatattattaataattaaattatgtatattatttttaattgccggtgaaaat
tttatcacaatgtttcccttttttaaaaaaataacggtattaaaaacggagttgaagcca
tctctatatgactataatgtaaagtcattaaatggaaccgatgtaccaatgtcaaactac
aaaaacaaagtcttaattatttttaattccgcatcaaagtgtggattaactaaaaatcat
gttaatcaatttaatgaattacatgaaaaattcaatgataaaggattagagattttgggc
ttccctacatatcagttttttagccaagaatttaaacaaagttgcgatatcagccaattt
aatcaagagaaaaatataaaataccatgtctttgctcctgttgaagttaatggggaaaat
acccacgaactttttaagtaccttaaatttaactgcaacgagatgcatgatgaaaacggt
gtactagaaaacatcggatggaactttggaaaattcttagtagacaaaaatggaaatgta
gttaagtattattctccaaaacttagcccaatgtatatggaaaaagatattaccgattta
ttataa

DBGET integrated database retrieval system