KEGG   Plasmodium chabaudi: PC000736.03.0Help
Entry
PC000736.03.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PC000736.03.0
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PC000736.03.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 206 aa AA seqDB search
MTIVKVTVKWKTNVYNDLELNINEPITSFKEQLWKLTAVPTEKQKLMYKGLIKDDTDLHT
LNIKNNDKIMLVGSSEALAEKPDKITFLEDLSKEDKEKFNEDKNIIFEDQGIVNLGNTCY
FNAVLQFLTSFNDLGEFLCNIKKKQKLGFRSNKDILFDCYIHFSQTFGKSSEPYVPLELL
KAFRDVFPKFKTVNVRTKQYAQQDAE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagttaaggtaacagtcaaatggaaaacaaatgtttacaatgatctcgagctt
aacataaacgaaccaataacatcatttaaagagcagttatggaaactaactgcggttccc
acagaaaagcaaaagctaatgtacaaggggctcataaaagatgacaccgatttacacaca
ttgaacataaaaaataatgacaaaattatgttagtagggtcctcagaagcattagctgaa
aaacctgataaaattacatttttagaagatttatcaaaagaagataaagaaaaatttaac
gaagataaaaatattattttcgaagatcaaggtatagtaaatttagggaacacttgctat
tttaatgccgttttgcaatttttaacttcttttaatgacttaggagaatttttatgtaat
ataaaaaaaaaacaaaaacttggattcagatcaaataaagatatattatttgattgttat
atacatttttctcaaacatttggaaaatcatcggagccatatgttcctttagaattatta
aaagcctttagagatgtttttcctaaatttaaaacggtcaatgtaagaacaaaacaatat
gcacaacaagatgcagaa

DBGET integrated database retrieval system