KEGG   Plasmodium chabaudi: PC000791.00.0Help
Entry
PC000791.00.0     CDS       T01108                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC000791.00.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC000791.00.0
   00620 Pyruvate metabolism
    PC000791.00.0
   00640 Propanoate metabolism
    PC000791.00.0
Enzymes [BR:pcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PC000791.00.0
Lipid biosynthesis proteins [BR:pcb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PC000791.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 825 aa AA seqDB search
NNLRWSQLFNKTYIGNFNKGNVSWFVNGKINACDNCVDRWVEKHPNKTAIIWEKDTPNDS
KKISYQKLLEKVCKIANLLKMYGVKKQDCVTIYLPMIPELIYSMLACARIGAIHNVVFAG
YSTRSLSERIISSGSTILITSDFGLRGGKLTKLKNIADGAMEMTGMIKTCIVFKNKTKIN
DQNNSILNSKSNNLYNSSNICSQGSSHFLQYYTVGNATHKNNNDPSQNGHDSVLHNDTND
ANLSQNNKIDKKGAKEKDIQTLNKLISKNTNLNKKTQNKESGTYKELYSNNDQYRIDGKE
NKLNENGAQMNGHISYDNNMINHNQVNAFEQLNNYNMHNGQPNCEQNCKSKYDFDENICT
LKEGRDINGSLLMKNMRPYCPIEYVDSEDFLCILYTSGSTGKPKGVTHTTAGYLLYAFAT
SKYIFDIKDDDIFGCVADIGWVTGHTYVVYGPLLNGITTTLFSSIPTYPDCSRYWSLIQT
HKITQFYTAPTALRTLMKHGDYYIKNYDLSSCRILGSVGEPINPETWRWYYNVVGKKKCV
IVDTYWQTETGGIVIAPIPHLFKMKPGSASLPFFGIQLEILNSKTLEPLNGPNVCGILCI
KSSWPGMLRTVYGNHNRLIKTYFEPCPNYYFTGDGAYRDEDGYYWISGRIDDTLNVSGHR
LGAAEIEHALVQHSCISESAVVSFSHKVKGEGILCFVVKKIASLSKYPECNNDNNNDELN
NRSILSSNGDIVQNHTHENYTDEKLIEELKQYVRKVIGPIATPDIICIVPDLPKTRSGKI
IRRILRAIAIGVNDYGDISTVSNYDVIEIIKNKFVESKEKRYSIS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
aataatttaaggtggtctcaattatttaataagacgtatattggcaattttaataaagga
aatgttagctggtttgttaatggcaaaataaatgcctgtgacaattgtgttgacagatgg
gttgaaaaacatcctaataagactgccattatatgggaaaaagatacaccaaatgattct
aaaaaaataagctatcaaaaattattagaaaaagtttgtaaaattgctaatttattaaaa
atgtatggagttaaaaaacaagattgtgtaaccatttatttgccaatgataccagaattg
atatattctatgttagcatgcgctagaataggtgctatacacaatgttgtttttgctgga
tattctactaggagtttatcagaaaggataatcagttcaggatcaactattttaattact
agcgattttggcttaaggggtggtaaattaaccaaattaaaaaatattgccgatggggca
atggaaatgactggaatgatcaaaacatgtatcgtttttaaaaacaaaacaaaaataaat
gatcagaacaatagcatattaaatagtaaatcaaataatttgtataattcatctaatata
tgctctcaaggaagtagccatttcttgcaatattacacagttggaaatgcaacacataaa
aataataatgatccaagtcaaaatgggcatgatagtgtattacataatgatactaatgat
gccaatttatcccaaaataataaaatcgataaaaagggtgctaaggaaaaagatatacaa
acacttaataaattaatatcaaaaaataccaatctaaataaaaaaactcaaaacaaggaa
agtggtacatacaaagaattatatagcaacaatgatcaatatcgaatagatggaaaggaa
aataaattgaatgaaaatggggcacaaatgaatgggcacatttcatatgataataatatg
attaaccataatcaagtaaatgcatttgaacagcttaataattataatatgcacaatggg
caacccaattgtgagcaaaattgtaaaagtaaatatgattttgatgaaaatatatgtaca
ctaaaagaaggtcgagatattaatggctcattattaatgaaaaatatgagaccatattgc
ccaatagaatatgtagatagtgaagattttttatgtatattatatacatctggttctact
gggaaaccgaaaggagtgactcatactactgcagggtatttattatatgcatttgcaaca
tccaaatatatttttgatataaaagatgatgatatttttggttgtgttgctgatataggt
tgggtaacaggccatacttatgtagtatatggaccattattaaatggaataacaaccacc
ttattttcatctatacctacctatcctgattgtagtagatattggagcttaatacaaact
cataaaataacacaattttatacagcccctactgcacttagaactttaatgaagcatggt
gattattatattaaaaattatgatttatcatcttgtagaatattaggaagtgtaggagaa
cctataaacccagaaacatggagatggtattataatgttgttggaaaaaaaaaatgtgta
attgtcgatacatattggcaaacagaaacgggaggtattgttattgcacccataccccat
ttatttaaaatgaaaccaggatctgcttctttaccattttttggtatccaattagaaata
ttaaattcaaaaacattagagccattaaatggcccaaatgtatgtggtatattatgtata
aaaagttcatggccaggtatgttaagaacagtttatggaaatcataatagattaatcaaa
acatattttgaaccatgccccaattactattttactggagatggtgcatatagagatgaa
gatgggtattattggatatcaggaaggattgatgatacactaaatgtatcaggtcatagg
ctaggcgctgcagaaattgaacacgcattagttcaacattcttgcatttctgaatcagcc
gttgtatctttttctcataaagttaaaggggaaggtattctatgttttgtcgttaaaaaa
attgcaagtctttcaaaatatccagaatgtaataatgataataataatgatgaactaaat
aatcgatctatattaagttcaaatggcgatattgtacaaaatcatactcatgaaaattat
accgatgaaaaattgatagaagaattgaaacaatatgttagaaaagttattgggccaatt
gctacaccagatataatatgtattgtccctgatttgccaaaaacaagaagtggaaaaatt
ataagaagaatattaagagctatagcaatcggagtgaatgattatggggatatatcaact
gtttcaaattatgatgttattgaaattattaaaaataaatttgtggaatctaaggaaaaa
cgttattccatatcataa

DBGET integrated database retrieval system