KEGG   Plasmodium chabaudi: PCHAS_083590Help
Entry
PCHAS_083590      CDS       T01108                                 

Gene name
PC000802.04.0
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PCHAS_083590 (PC000802.04.0)
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PCHAS_083590 (PC000802.04.0)
Messenger RNA biogenesis [BR:pcb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PCHAS_083590 (PC000802.04.0)
Chromosome [BR:pcb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PCHAS_083590 (PC000802.04.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 341 aa AA seqDB search
MIQFLKNLQLYKKRETPDIKPTTKKSKMKYEDFNFIRTLGTGSFGRVILATYKNEDLPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYISHPFCVNLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYEILVGYPPFYANEPLLIYQK
ILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQSVKEHPWFANIEWNRLLNKR
VDVPYKPKYKNILDASNFEQVQEDLSIADKVINENDPFYDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattccttaaaaatctacagctatacaaaaagagggaaacacccgatataaaa
cccacgactaaaaaaagtaaaatgaaatatgaagattttaatttcattcgtacacttggg
actggctcatttggacgagtaattttagcgacgtataaaaatgaggatttgcctccagtg
gcaattaagcgatttgaaaaaagcaaaataataaaacaaaaacaagtcgatcatgtattt
tctgaaaggaaaatattaaactatataagtcaccctttttgcgttaatttatatggatct
tttaaggatgagtcttatttatatttagttcttgaatttgtaattgggggtgaatttttt
acctttttaagaagaaataaaagatttccaaatgatgttggatgcttttatgcagcacaa
atagttttaatatttgaatatttacaaagtttaaacattgtatacagggacttgaaaccg
gagaacttgctcctcgataaggacggatttataaagatgactgactttggttttgcaaaa
gttgtaaatacacgaacatacacattatgtgggacaccagaatatatcgccccagaaata
ttgttaaatgcgggtcatggaaaggcggtggactggtggacgctgggaattttcatatac
gagattttggttgggtacccccccttttatgcaaatgagcctctactaatatatcagaaa
attttagagggtataatatacttccctaaatttttagataacaattgtaagcacttaatg
aaaaaattattatctcatgatcttacaaagagatatggaaatttaaaaaagggagctcaa
agtgttaaggagcatccatggtttgctaatattgaatggaatagattattaaataaaaga
gttgatgtaccatataaacctaaatataaaaatatacttgatgcttctaatttcgagcaa
gttcaagaagatttatctatagcagataaagttattaatgaaaacgatccattttacgat
tggtaa

DBGET integrated database retrieval system