KEGG   Plasmodium chabaudi: PC000802.04.0Help
Entry
PC000802.04.0     CDS       T01108                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
Organism
pcb  Plasmodium chabaudi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MIQFLKNLQLYKKRETPDIKPTTKKSKMKYEDFNFIRTLGTGSFGRVILATYKNEDLPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYISHPFCVNLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYEILVGYPPFYANEPLLIYQK
ILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQSVKEHPWFANIEWNRLLNKR
VDVPYKPKYKNILDASNFEQVQEDLSIADKVINENDPFYDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattccttaaaaatctacagctatacaaaaagagggaaacacccgatataaaa
cccacgactaaaaaaagtaaaatgaaatatgaagattttaatttcattcgtacacttggg
actggctcatttggacgagtaattttagcgacgtataaaaatgaggatttgcctccagtg
gcaattaagcgatttgaaaaaagcaaaataataaaacaaaaacaagtcgatcatgtattt
tctgaaaggaaaatattaaactatataagtcaccctttttgcgttaatttatatggatct
tttaaggatgagtcttatttatatttagttcttgaatttgtaattgggggtgaatttttt
acctttttaagaagaaataaaagatttccaaatgatgttggatgcttttatgcagcacaa
atagttttaatatttgaatatttacaaagtttaaacattgtatacagggacttgaaaccg
gagaacttgctcctcgataaggacggatttataaagatgactgactttggttttgcaaaa
gttgtaaatacacgaacatacacattatgtgggacaccagaatatatcgccccagaaata
ttgttaaatgcgggtcatggaaaggcggtggactggtggacgctgggaattttcatatac
gagattttggttgggtacccccccttttatgcaaatgagcctctactaatatatcagaaa
attttagagggtataatatacttccctaaatttttagataacaattgtaagcacttaatg
aaaaaattattatctcatgatcttacaaagagatatggaaatttaaaaaagggagctcaa
agtgttaaggagcatccatggtttgctaatattgaatggaatagattattaaataaaaga
gttgatgtaccatataaacctaaatataaaaatatacttgatgcttctaatttcgagcaa
gttcaagaagatttatctatagcagataaagttattaatgaaaacgatccattttacgat
tggtaa

DBGET integrated database retrieval system