KEGG   Plasmodium chabaudi: PC000873.02.0Help
Entry
PC000873.02.0     CDS       T01108                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pcb  Plasmodium chabaudi
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PC000873.02.0
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PC000873.02.0
   00670 One carbon pool by folate
    PC000873.02.0
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PC000873.02.0
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PC000873.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
NTDGIPSVDKLQNIVVMGKASWESIPSKFKPLQNRINIILSRTLKKEDLAKEYNNVIIIN
SVDDLFPILKSIKYYKCFVIGGASVYKEFLDRNLIKKIYFTRINNAYTCDVLFPDINEDL
FKITSISDVYSSNNTTLDFVIYSKTKEIPEEINPNDEIFNNAFLGVCDEKNTNFDDEDDY
TYFSFNKHKDNIKKNSEHAHHFKIYNSIKYKHHPEYQYLNIIYDIIMHGNKQDDRTGVGV
LSKFGYMMKFNLSEYFPLLTTKKLFVRGIIEELLWFIRGETNGNTLLEKNVRIWEANGTR
EFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTDMHADYKDKGVDQLKNIINLIKNDPTCR
RIILCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTY
MIAQVCNLQPAEFIHVLGNAHVYNNHVESLKVQLNRTPYPFPTLKLNPEIKNIEDFTISD
FTVQNYVHHDKISMDMAA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
aatactgatggaataccctccgttgataagttacaaaatattgtagtaatgggaaaagca
agttgggaaagcatcccctcaaaatttaagccattacaaaatcgaataaatattatattg
tctagaacattgaaaaaagaagatcttgcaaaagaatataataatgttattataattaat
agtgtggatgatttatttcctattttaaaatccataaaatattataaatgttttgttata
ggaggtgcatctgtttataaagaatttttagatcgtaatttaataaaaaaaatatatttt
acaagaataaataatgcttatacgtgtgatgttttatttccagatatcaatgaagattta
tttaaaataacatcaattagtgatgtatatagtagtaataacacgactttagattttgta
atttatagtaagacaaaagaaatacctgaagaaattaatcccaacgatgaaatatttaat
aacgcatttttaggtgtgtgtgatgaaaaaaatacaaattttgatgatgaagatgattat
acatatttcagttttaataaacataaagataatattaaaaaaaattcagagcatgctcat
cattttaaaatatataatagtataaaatataaacatcatcctgaatatcaatatttaaat
attatatatgatataataatgcatggaaataaacaagatgatagaacaggtgttggtgta
ttaagtaaatttggatatatgatgaaatttaatttaagtgaatattttccattattaaca
acaaaaaaattatttgtaagaggtatcattgaagagttgctatggtttataaggggagaa
acaaatggaaatacattattagaaaaaaacgtaagaatatgggaagctaatgggacaaga
gagtttttagataataggaaattatttcatagagaagttaatgacttaggtccaatttac
ggatttcaatggaggcactttggtgctgaatatacagatatgcatgctgattataaagat
aaaggtgttgatcagttaaaaaatattataaatttaattaaaaacgatccgacatgtaga
cgaattattttatgtgcatggaatgtaaaagatttagatcaaatggcattacctccttgt
catattttatgtcaattttatgtttttgatggaaaattatcatgtattatgtatcaaaga
tcttgtgatttaggtcttggtgttccattcaatattgcttcctattctatatttacatat
atgatagcacaagtatgtaatttacaaccagctgaatttatacatgtattgggaaatgct
catgtttataataatcatgttgaaagcttaaaagtccagttaaatagaacaccctatcct
ttccctactcttaaattaaatccggaaattaaaaatatcgaggattttacaatttcagat
tttactgtacaaaattatgtccatcacgataaaatcagtatggatatggcagcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system