KEGG   Plasmodium chabaudi: PCHAS_072830Help
Entry
PCHAS_072830      CDS       T01108                                 

Gene name
PC000873.02.0
Definition
(RefSeq) bifunctional dihydrofolate reductase-thymidylate synthase, putative
  KO
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pcb  Plasmodium chabaudi
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PCHAS_072830 (PC000873.02.0)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCHAS_072830 (PC000873.02.0)
   00670 One carbon pool by folate
    PCHAS_072830 (PC000873.02.0)
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PCHAS_072830 (PC000873.02.0)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PCHAS_072830 (PC000873.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 583 aa AA seqDB search
MEDISEIFDIYAICACCKVLNSNEKASCFSNKTFKGLGNEGGLPWKCNSVDMKHFSSVTS
YVNETNYMRLKWKRDRYMEKNNVKLNTDGIPSVDKLQNIVVMGKASWESIPSKFKPLQNR
INIILSRTLKKEDLAKEYNNVIIINSVDDLFPILKSIKYYKCFVIGGASVYKEFLDRNLI
KKIYFTRINNAYTCDVLFPDINEDLFKITSISDVYSSNNTTLDFVIYSKTKEIPEEINPN
DEIFNNAFLGVCDEKNTNFDDEDDYTYFSFNKHKDNIKKNSEHAHHFKIYNSIKYKHHPE
YQYLNIIYDIIMHGNKQDDRTGVGVLSKFGYMMKFNLSEYFPLLTTKKLFVRGIIEELLW
FIRGETNGNTLLEKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTDMH
ADYKDKGVDQLKNIINLIKNDPTCRRIILCAWNVKDLDQMALPPCHILCQFYVFDGKLSC
IMYQRSCDLGLGVPFNIASYSIFTYMIAQVCNLQPAEFIHVLGNAHVYNNHVESLKVQLN
RTPYPFPTLKLNPEIKNIEDFTISDFTVQNYVHHDKISMDMAA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaagatatctctgaaatattcgatatatatgcaatttgtgcatgttgtaaagttctg
aacagtaatgaaaaggctagctgttttagtaataagacttttaagggacttgggaatgaa
ggggggttaccttggaaatgtaattcagtagatatgaaacattttagttctgtaacatcc
tatgttaatgaaactaactatatgagattaaaatggaaaagggatagatatatggaaaaa
aataatgtaaaattaaatactgatggaataccctccgttgataagttacaaaatattgta
gtaatgggaaaagcaagttgggaaagcatcccctcaaaatttaagccattacaaaatcga
ataaatattatattgtctagaacattgaaaaaagaagatcttgcaaaagaatataataat
gttattataattaatagtgtggatgatttatttcctattttaaaatccataaaatattat
aaatgttttgttataggaggtgcatctgtttataaagaatttttagatcgtaatttaata
aaaaaaatatattttacaagaataaataatgcttatacgtgtgatgttttatttccagat
atcaatgaagatttatttaaaataacatcaattagtgatgtatatagtagtaataacacg
actttagattttgtaatttatagtaagacaaaagaaatacctgaagaaattaatcccaac
gatgaaatatttaataacgcatttttaggtgtgtgtgatgaaaaaaatacaaattttgat
gatgaagatgattatacatatttcagttttaataaacataaagataatattaaaaaaaat
tcagagcatgctcatcattttaaaatatataatagtataaaatataaacatcatcctgaa
tatcaatatttaaatattatatatgatataataatgcatggaaataaacaagatgataga
acaggtgttggtgtattaagtaaatttggatatatgatgaaatttaatttaagtgaatat
tttccattattaacaacaaaaaaattatttgtaagaggtatcattgaagagttgctatgg
tttataaggggagaaacaaatggaaatacattattagaaaaaaacgtaagaatatgggaa
gctaatgggacaagagagtttttagataataggaaattatttcatagagaagttaatgac
ttaggtccaatttacggatttcaatggaggcactttggtgctgaatatacagatatgcat
gctgattataaagataaaggtgttgatcagttaaaaaatattataaatttaattaaaaac
gatccgacatgtagacgaattattttatgtgcatggaatgtaaaagatttagatcaaatg
gcattacctccttgtcatattttatgtcaattttatgtttttgatggaaaattatcatgt
attatgtatcaaagatcttgtgatttaggtcttggtgttccattcaatattgcttcctat
tctatatttacatatatgatagcacaagtatgtaatttacaaccagctgaatttatacat
gtattgggaaatgctcatgtttataataatcatgttgaaagcttaaaagtccagttaaat
agaacaccctatcctttccctactcttaaattaaatccggaaattaaaaatatcgaggat
tttacaatttcagattttactgtacaaaattatgtccatcacgataaaatcagtatggat
atggcagcttaa

DBGET integrated database retrieval system