KEGG   Plasmodium chabaudi: PCHAS_136230Help
Entry
PCHAS_136230      CDS       T01108                                 

Gene name
PC000879.01.0
Definition
(RefSeq) aspartate carbamoyltransferase, putative
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00240  Pyrimidine metabolism
pcb00250  Alanine, aspartate and glutamate metabolism
pcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PCHAS_136230 (PC000879.01.0)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCHAS_136230 (PC000879.01.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PCHAS_136230 (PC000879.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 3498527
NCBI-ProteinID: XP_745405
UniProt: A0A077TUL0
Position
13
AA seq 372 aa AA seqDB search
MGRIIDSIISGGVLLTATLLTCKYLKDRKRQLTIEGECEAKTKFNVDLNKIIEKMKNKHV
INIEDISDEELIAILFTAKTFEKILRDKKDSKYLKDKVFCSLFTEPSTRTRCSFDAAILR
LGSKVINITDVNSTSFYKGETVQDTFSVMSKYVDGIIYRDASNNNIDLAIETSTKPIINA
GNGTGEHPTQSLLDFYTIYNFFPYILDRNPNKKLKIAFVGDLKNGRTIHSLSKLLSRYNV
SFNFVSCKSLDIPDNIINIISDNLKKNNFYDDNSINKYDNLEKGLEDTHIVYMTRIQKER
FTDMSEYNKYKDSFILDNNALRNTRPDAKVLHPLPRVNEIKIEVDENPKSVYFLQAENGL
YVRMALLYLIFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggatcattgattcgataatttcaggtggtgttcttttaacagccacattatta
acatgcaaatatcttaaagacagaaaaaggcaactaacaattgaaggggaatgtgaagca
aaaactaaattcaatgtcgatctgaataagataatagaaaaaatgaaaaataagcatgtt
ataaacattgaagatataagcgatgaagaattgatagcaattttatttacagcaaaaaca
tttgaaaaaatattaagagataagaaggactccaaatatttgaaagataaagttttctgt
agtttatttacagagccaagtacacgaacgagatgttcttttgatgctgctattttaaga
ttaggctcaaaagtaataaatattacggatgtaaattcaacttccttttataaaggagaa
actgtacaggatactttttctgttatgtcaaaatatgttgatggaattatatacagagat
gcttcaaataataatattgatttggcaattgaaacgtcaaccaagccaattatcaacgcg
gggaacggaaccggagaacatccaacacagtcccttttagacttttacacaatatataat
tttttcccatatattttggatagaaacccaaacaaaaaacttaagattgcatttgttggg
gatttaaaaaacggaagaactattcattctcttagtaaattacttagtagatataatgtt
agtttcaattttgtttcatgtaaatcattagacattcctgataatataataaatattata
tctgataatttgaaaaaaaataatttttatgacgataattctataaacaaatatgataat
ttagaaaagggattagaggatactcatattgtatatatgacgagaattcaaaaagaaaga
tttacagatatgagcgaatataataaatacaaagattcttttattttggataacaatgcg
ttaagaaatacaagacccgacgccaaggttcttcacccccttccaagggttaatgaaata
aaaatagaggttgatgaaaatcctaagagtgtctattttttgcaagctgaaaatggttta
tatgtacgaatggcattgttataccttattttctcataa

DBGET integrated database retrieval system