KEGG   Plasmodium chabaudi: PC000879.01.0Help
Entry
PC000879.01.0     CDS       T01108                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pcb  Plasmodium chabaudi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PC000879.01.0
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PC000879.01.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PC000879.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MGRIIDSIISGGVLLTATLLTCKYLKDRKRQLTIEGECEAKTKFNVDLNKIIEKMKNKHV
INIEDISDEELIAILFTAKTFEKILRDKKDSKYLKDKVFCSLFTEPSTRTRCSFDAAILR
LGSKVINITDVNSTSFYKGETVQDTFSVMSKYVDGIIYRDASNNNIDLAIETSTKPIINA
GNGTGEHPTQSLLDFYTIYNFFPYILDRNPNKKLKIAFVGDLKNGRTIHSLSKLLSRYNV
SFNFVSCKSLDIPDNIINIISDNLKKNNFYDDNSINKYDNLEKGLEDTHIVYMTRIQKER
FTDMSEYNKYKDSFILDNNALRNTRPDAKVLHPLPRVNEIKIEVDENPKSVYFLQAENGL
YVRMALLYLIFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggatcattgattcgataatttcaggtggtgttcttttaacagccacattatta
acatgcaaatatcttaaagacagaaaaaggcaactaacaattgaaggggaatgtgaagca
aaaactaaattcaatgtcgatctgaataagataatagaaaaaatgaaaaataagcatgtt
ataaacattgaagatataagcgatgaagaattgatagcaattttatttacagcaaaaaca
tttgaaaaaatattaagagataagaaggactccaaatatttgaaagataaagttttctgt
agtttatttacagagccaagtacacgaacgagatgttcttttgatgctgctattttaaga
ttaggctcaaaagtaataaatattacggatgtaaattcaacttccttttataaaggagaa
actgtacaggatactttttctgttatgtcaaaatatgttgatggaattatatacagagat
gcttcaaataataatattgatttggcaattgaaacgtcaaccaagccaattatcaacgcg
gggaacggaaccggagaacatccaacacagtcccttttagacttttacacaatatataat
tttttcccatatattttggatagaaacccaaacaaaaaacttaagattgcatttgttggg
gatttaaaaaacggaagaactattcattctcttagtaaattacttagtagatataatgtt
agtttcaattttgtttcatgtaaatcattagacattcctgataatataataaatattata
tctgataatttgaaaaaaaataatttttatgacgataattctataaacaaatatgataat
ttagaaaagggattagaggatactcatattgtatatatgacgagaattcaaaaagaaaga
tttacagatatgagcgaatataataaatacaaagattcttttattttggataacaatgcg
ttaagaaatacaagacccgacgccaaggttcttcacccccttccaagggttaatgaaata
aaaatagaggttgatgaaaatcctaagagtgtctattttttgcaagctgaaaatggttta
tatgtacgaatggcattgttataccttattttctcataa

DBGET integrated database retrieval system