KEGG   Plasmodium chabaudi: PCHAS_080680Help
Entry
PCHAS_080680      CDS       T01108                                 

Gene name
PC000905.02.0
Definition
(RefSeq) triosephosphate isomerase, putative
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCHAS_080680 (PC000905.02.0)
   01230 Biosynthesis of amino acids
    PCHAS_080680 (PC000905.02.0)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCHAS_080680 (PC000905.02.0)
   00051 Fructose and mannose metabolism
    PCHAS_080680 (PC000905.02.0)
   00562 Inositol phosphate metabolism
    PCHAS_080680 (PC000905.02.0)
Enzymes [BR:pcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PCHAS_080680 (PC000905.02.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PCHAS_080680 (PC000905.02.0)
  Exosomal proteins of bladder cancer cells
   PCHAS_080680 (PC000905.02.0)
  Exosomal proteins of melanoma cells
   PCHAS_080680 (PC000905.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 352 aa AA seqDB search
MLKLFWGIYIFLMTTECMKYNYKNSNNLFNNHKTIKKQFFIKSRLPLDRIKDNHTYDIKP
WTKLGIKRYTNKKNNEVYSFINDNNANLETENRKKKIIIANWKCYLLKEEAYKLIDKLTQ
IKFSNYIDVIVSPNLLFLPYLHEKIKQNNSKISPCSQDVSLVNGLGAFTGETTANLLHEL
GISYTIIGHSERKKGFFNVGENIEQTALKVYNAINSKLKVILCVGENYTSRECSFPFQRF
RELLSLIKQKIPKEEIKNIIIAFEPRFAVGTGNPVSSSNLNSCCFDIRRAILDEIDENTS
KCIKIVYGGSITKSNVQDYIENTLIDGFLIGKSSIDETFIDIIKHVDNSHHL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaactattttggggaatatacatttttctaatgaccactgaatgtatgaaatat
aattataaaaattcaaataacttatttaacaaccataaaacaatcaagaagcaatttttc
attaaatcaaggttgccactagataggataaaagataatcatacatatgatataaaacca
tggacaaaactaggaataaagcgatataccaataaaaaaaataatgaggtatactcattt
ataaatgacaacaatgcaaatttagagaccgaaaatcggaagaaaaaaataatcatagct
aactggaaatgttatttgttaaaagaagaagcgtataaactaatcgacaaattaacacaa
attaaattttcaaattatattgatgtaattgtatcccccaatttattatttttaccttat
cttcatgaaaaaataaagcaaaataattccaaaatatccccatgctctcaagatgtaagt
ttagtaaatggtttaggggcatttacaggggaaacaacagcgaatttgctacatgaattg
ggaataagttatacaataatagggcatagtgaaagaaaaaagggtttttttaatgttggt
gaaaacattgaacaaacggcattgaaagtatataatgcaattaattccaaattaaaagtt
attttatgtgtaggagaaaattacacaagcagagaatgcagtttcccctttcaaagattt
agagaattgctttctctaattaaacaaaaaattccaaaagaagaaattaaaaatataatt
atagcctttgagcccagatttgctgtaggaactgggaatcctgtatcctcgtctaaccta
aatagttgttgttttgatataagaagagcgatattggatgaaattgatgaaaatacaagt
aaatgcataaaaattgtttatggtggatctataacaaaatcgaacgtccaggattatata
gaaaacactttaattgatggttttctaattggaaaaagttcgattgatgaaacatttatt
gacataataaagcatgttgataattctcatcacctataa

DBGET integrated database retrieval system