KEGG   Plasmodium chabaudi: PC000905.02.0Help
Entry
PC000905.02.0     CDS       T01108                                 

Definition
triosephophate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC000905.02.0
   01230 Biosynthesis of amino acids
    PC000905.02.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC000905.02.0
   00051 Fructose and mannose metabolism
    PC000905.02.0
   00562 Inositol phosphate metabolism
    PC000905.02.0
Enzymes [BR:pcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PC000905.02.0
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PC000905.02.0
  Exosomal proteins of bladder cancer cells
   PC000905.02.0
  Exosomal proteins of melanoma cells
   PC000905.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 197 aa AA seqDB search
RKKKIIIANWKCYLLKEEAYKLIDKLTQIKFSNYIDVIVSPNLLFLPYLHEKIKQNNSKI
PSSQDVSLVNGLGAFTGETTANLLHELGISYTIIGHSERKKGFFNVGENIEQTALKVYNA
INSKLKVILCVGENYTSRECSFPFQRFRELLSLIKQKIPKEEIKNIIIAFEPRFAVGTGN
PVSSSNLNSCCFGILKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
cggaagaaaaaaataatcatagctaactggaaatgttatttgttaaaagaagaagcgtat
aaactaatcgacaaattaacacaaattaaattttcaaattatattgatgtaattgtatcc
cccaatttattatttttaccttatcttcatgaaaaaataaagcaaaataattccaaaata
cccagctctcaagatgtaagtttagtaaatggtttaggggcatttacaggggaaacaaca
gcgaatttgctacatgaattgggaataagttatacaataatagggcatagtgaaagaaaa
aagggtttttttaatgttggtgaaaacattgaacaaacggcattgaaagtatataatgca
attaattccaaattaaaagttattttatgtgtaggagaaaattacacaagcagagaatgc
agtttcccctttcaaagatttagagaattgctttctctaattaaacaaaaaattccaaaa
gaagaaattaaaaatataattatagcctttgagcccagatttgctgtaggaactgggaat
cctgtatcctcgtctaacctaaatagttgttgttttggtattcttaaaaaataa

DBGET integrated database retrieval system