KEGG   Plasmodium chabaudi: PC000906.02.0Help
Entry
PC000906.02.0     CDS       T01108                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pcb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcb00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pcb00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pcb00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pcb00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1208 aa AA seqDB search
MEKHREKESNPSQVKDTEMLNCLMQKLTSKNFLEEKETKNRFYLVENKDVKIKKLKEHGH
SASLNDNLSPLQYERIKYKPTLPKALASEYQILDEDFGDEFINKKEYEEIKKFFKSIDGL
PMINVKETKNNESFKGGNILKIGIILSGGPAPGGHNVISGIYDYAKRYNEESQVIGFLGG
IDGLYNKNYVTITDNLMNKFRNLGGFNMLWSGRGKVKNKDDLLAIENIVLKLKLNGLVII
GGDGSNSNAALISEYLKERNVPISVIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGN
LCTDVKTGNNVYHVVRVMGRSASHVVLECALQTRPNVVLIGEEVERDKIPLKTIVSNIVN
IILKRHDLNKDYGVILLPEGLIEFIPEMKILIEELNIILKTSDRSEPFDPSKLKESKELW
NFLPQIIRDQLLLDRESTGYIQVGKVATERLIINLVESELAKLKDVNLNIHFMAHYLGYE
GRCALPSNFDCNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHVC
KDNLGKEYPAVKKYLVDLNSPLFKVLKEVQNLWSLYDLYRSPGPIQFNGYLSNYRCYTVK
IPQKDELLCQNSDDLNIIINSTTKGGNDKTEDSPVRNFNNQNKNGDSEVQHQSGYKSLGC
MSELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPNMSYENKFQIQE
IFHDKYASPIAFEIKIGIVFLSRQSPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLNNKY
IIINDENIAKHLNQGGLELTGNSPEHSLFDEENRNKVCETVSKLQLNGLVMPGSNVTITE
AALLAEYFLEKKIHTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSM
PKYWHFIRLMGRSPSHEVLECALQTHPNMVIIAEEYGAADKTLWRVVQDIADVICARAEL
GKNYGTVLIPDALLMHLPHMKILLTEISDILNEASEKGEVIQARNDLVNLSNEKIEKESP
WIAKLTPWSLALIKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKAKGKY
SGVFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDW
KLFAIPFISLMKILLRGQGSKSLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMED
SSCNPGPI
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcatagagagaaagaaagtaaccctagtcaagttaaagacacagagatgtta
aattgtttgatgcaaaagttaacttcaaaaaattttttagaagaaaaagaaacaaaaaat
cgattttatttagtagaaaataaggatgtaaaaataaaaaaattaaaagaacatggtcat
tcagcatctttaaatgataatctaagtccattacaatatgaaaggataaaatataaacct
acattacctaaggccttagcaagtgaatatcaaatattagatgaagattttggagatgag
tttataaataaaaaagaatacgaagaaataaaaaaattttttaaaagtatagatggttta
ccaatgataaatgtaaaagaaacaaaaaataatgaatcatttaaaggtggaaatatatta
aaaattggtattatattatctggaggtccagcaccaggaggacataatgttatatcaggt
atttatgattatgcaaaacgatataatgaagaatctcaagttattggatttttaggaggt
atagatggtttatataataaaaattatgtaacaataacagataacttaatgaataagttt
cgtaatttaggtggttttaatatgttatggtcaggtagaggtaaagttaaaaataaagat
gatttgctagctattgaaaatattgttttaaaattaaaattaaacggtttagtaattata
ggaggtgatggctcaaatagtaatgccgcattaatttctgaatatcttaaagaaagaaat
gttcctatctctgttataggtgtacccaaaacaattgatggtgatttaaagagtgaagca
attgaaataagttttggatttgataccgcaactagaacctattctgaaataataggaaat
ttatgtacagatgtaaaaacaggaaataatgtttatcatgttgttcgagttatgggacga
tctgcttcacatgttgtgctcgaatgtgcattacaaacaagaccaaatgttgtattgatt
ggtgaagaagtcgaaagagataaaataccactaaaaactattgtaagtaatattgttaat
ataatattaaaaagacatgatttaaataaagattatggtgtaattttattaccagagggg
ttaatagaatttatacccgaaatgaaaatattaattgaagaattaaatattattttaaaa
acatcggatcgatcggaaccatttgatccatctaaattaaaagaatcaaaagaattatgg
aatttcttaccacaaataattagggaccaattgttattagatagagaatcaactggttat
atacaagttggaaaagttgcaacagaaagattaataataaatttagttgaatccgaatta
gctaaattaaaagatgttaatttgaatattcattttatggcccattacttaggatatgaa
ggtagatgtgcattaccatcaaattttgattgtaactattgttattcattaggatataat
gctgcattattaattgatcataagaaaactggttacatgtcaatcatacgaaatttgaaa
aattcttatgaagattggatacccgctggtattccatttttaagaataatgcatgtatgt
aaagacaatttaggaaaagaatatccagctgtcaaaaaatacttagtagacttaaatagc
ccattatttaaagttttaaaagaagttcaaaatttatggtcgttatatgatttatataga
tcaccaggaccaatacaattcaatggctatttaagtaactacagatgttatactgttaaa
ataccacagaaagatgaattattatgtcaaaactcagatgatttgaatattataattaat
tcgactactaaaggtggcaatgacaaaacggaagatagtcctgttcggaatttcaataat
caaaataaaaatggagatagcgaagtacaacatcaatcaggatataagtcacttggatgc
atgtctgaattacaaacatcacgtttatataataaattggaattacctgaactatgttcc
gatttaaaagcaaaagtaagagcaggaaaacaatatatatcaaatgatccatatactcaa
aaacaaatattatcaaattatccaaacatgtcttacgaaaacaaatttcaaatccaagaa
atatttcatgataagtatgcatcacctatagcttttgaaatcaaaataggaattgtattt
ttatctagacaatccccaggtgctatgaatgtattatgtggtttatacagacgtttaaaa
ttgttaaaaggtgtttgtatagcattttatggattatatggcttattaaataataagtac
ataatcataaatgatgaaaacattgctaagcatttaaatcaaggtggtttagaattaaca
ggaaattcaccagaacattcattatttgatgaagagaatagaaataaagtttgtgaaact
gtatctaagttacaattaaatggtttggtaatgcctggttcaaatgtgaccataacagaa
gccgcattattagctgaatactttttagaaaaaaaaattcatacatctgttgttggaata
ccattaacgggttctaataatttgattcatgaattaattgaaacatgtgttggttttgat
agtagtacaaaagtttatgcatcattaattggtaatgttcttacagatgcagtcagtatg
cctaaatactggcatttcattcgattaatgggtcgttcaccatctcatgaagtattagaa
tgtgcattacaaacgcatccaaatatggttatcatagctgaagaatatggagcagctgat
aaaacactatggagagttgttcaagatatagctgatgtaatatgtgctagagcagaatta
ggaaagaattatggaacagttctaattccagatgcactattaatgcacttaccacatatg
aaaatattattaacagaaataagtgatatactaaatgaagcatcggaaaaaggagaagta
atacaagcaagaaatgatttagttaatttgtcaaatgaaaaaattgaaaaagaatcacca
tggatagcaaaattaacaccatggagtttagcattaatcaaaacattcccacaatttatt
attaaagaattattacatgttgatttaagatctatgcgttttgaaaaattagaaactgaa
caattattattacaaatggttaaagaagaattacatcaaagaaaagcaaaaggaaaatat
tccggagtgtttatggggttaacccattttttcggttatcaaggacgttcttcattacct
tcagagttcgattgtaagttagcatatgcatatggtcatgcagcttcaattgttattgaa
agtggattaacaggttatatagtatctataagaggtttatgtggtaatgttaatgattgg
aaattatttgcaattccatttatttctcttatgaaaatactattaagaggacaaggaagt
aaatcattaaagagtgcatccaaaggtgatttacccgtcattcctagtgcccctgttgat
ttaaacggaaaagcatatagaagtttaaaaattgctttacaaaaatggcaaatggaagat
agttcttgtaatcctggtccaata

DBGET integrated database retrieval system