KEGG   Plasmodium chabaudi: PC000906.02.0Help
Entry
PC000906.02.0     CDS       T01108                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC000906.02.0
   01230 Biosynthesis of amino acids
    PC000906.02.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC000906.02.0
   00030 Pentose phosphate pathway
    PC000906.02.0
   00051 Fructose and mannose metabolism
    PC000906.02.0
   00052 Galactose metabolism
    PC000906.02.0
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PC000906.02.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PC000906.02.0
Protein phosphatases and associated proteins [BR:pcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PC000906.02.0
Messenger RNA biogenesis [BR:pcb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PC000906.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1208 aa AA seqDB search
MEKHREKESNPSQVKDTEMLNCLMQKLTSKNFLEEKETKNRFYLVENKDVKIKKLKEHGH
SASLNDNLSPLQYERIKYKPTLPKALASEYQILDEDFGDEFINKKEYEEIKKFFKSIDGL
PMINVKETKNNESFKGGNILKIGIILSGGPAPGGHNVISGIYDYAKRYNEESQVIGFLGG
IDGLYNKNYVTITDNLMNKFRNLGGFNMLWSGRGKVKNKDDLLAIENIVLKLKLNGLVII
GGDGSNSNAALISEYLKERNVPISVIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGN
LCTDVKTGNNVYHVVRVMGRSASHVVLECALQTRPNVVLIGEEVERDKIPLKTIVSNIVN
IILKRHDLNKDYGVILLPEGLIEFIPEMKILIEELNIILKTSDRSEPFDPSKLKESKELW
NFLPQIIRDQLLLDRESTGYIQVGKVATERLIINLVESELAKLKDVNLNIHFMAHYLGYE
GRCALPSNFDCNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHVC
KDNLGKEYPAVKKYLVDLNSPLFKVLKEVQNLWSLYDLYRSPGPIQFNGYLSNYRCYTVK
IPQKDELLCQNSDDLNIIINSTTKGGNDKTEDSPVRNFNNQNKNGDSEVQHQSGYKSLGC
MSELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPNMSYENKFQIQE
IFHDKYASPIAFEIKIGIVFLSRQSPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLNNKY
IIINDENIAKHLNQGGLELTGNSPEHSLFDEENRNKVCETVSKLQLNGLVMPGSNVTITE
AALLAEYFLEKKIHTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSM
PKYWHFIRLMGRSPSHEVLECALQTHPNMVIIAEEYGAADKTLWRVVQDIADVICARAEL
GKNYGTVLIPDALLMHLPHMKILLTEISDILNEASEKGEVIQARNDLVNLSNEKIEKESP
WIAKLTPWSLALIKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKAKGKY
SGVFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDW
KLFAIPFISLMKILLRGQGSKSLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMED
SSCNPGPI
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcatagagagaaagaaagtaaccctagtcaagttaaagacacagagatgtta
aattgtttgatgcaaaagttaacttcaaaaaattttttagaagaaaaagaaacaaaaaat
cgattttatttagtagaaaataaggatgtaaaaataaaaaaattaaaagaacatggtcat
tcagcatctttaaatgataatctaagtccattacaatatgaaaggataaaatataaacct
acattacctaaggccttagcaagtgaatatcaaatattagatgaagattttggagatgag
tttataaataaaaaagaatacgaagaaataaaaaaattttttaaaagtatagatggttta
ccaatgataaatgtaaaagaaacaaaaaataatgaatcatttaaaggtggaaatatatta
aaaattggtattatattatctggaggtccagcaccaggaggacataatgttatatcaggt
atttatgattatgcaaaacgatataatgaagaatctcaagttattggatttttaggaggt
atagatggtttatataataaaaattatgtaacaataacagataacttaatgaataagttt
cgtaatttaggtggttttaatatgttatggtcaggtagaggtaaagttaaaaataaagat
gatttgctagctattgaaaatattgttttaaaattaaaattaaacggtttagtaattata
ggaggtgatggctcaaatagtaatgccgcattaatttctgaatatcttaaagaaagaaat
gttcctatctctgttataggtgtacccaaaacaattgatggtgatttaaagagtgaagca
attgaaataagttttggatttgataccgcaactagaacctattctgaaataataggaaat
ttatgtacagatgtaaaaacaggaaataatgtttatcatgttgttcgagttatgggacga
tctgcttcacatgttgtgctcgaatgtgcattacaaacaagaccaaatgttgtattgatt
ggtgaagaagtcgaaagagataaaataccactaaaaactattgtaagtaatattgttaat
ataatattaaaaagacatgatttaaataaagattatggtgtaattttattaccagagggg
ttaatagaatttatacccgaaatgaaaatattaattgaagaattaaatattattttaaaa
acatcggatcgatcggaaccatttgatccatctaaattaaaagaatcaaaagaattatgg
aatttcttaccacaaataattagggaccaattgttattagatagagaatcaactggttat
atacaagttggaaaagttgcaacagaaagattaataataaatttagttgaatccgaatta
gctaaattaaaagatgttaatttgaatattcattttatggcccattacttaggatatgaa
ggtagatgtgcattaccatcaaattttgattgtaactattgttattcattaggatataat
gctgcattattaattgatcataagaaaactggttacatgtcaatcatacgaaatttgaaa
aattcttatgaagattggatacccgctggtattccatttttaagaataatgcatgtatgt
aaagacaatttaggaaaagaatatccagctgtcaaaaaatacttagtagacttaaatagc
ccattatttaaagttttaaaagaagttcaaaatttatggtcgttatatgatttatataga
tcaccaggaccaatacaattcaatggctatttaagtaactacagatgttatactgttaaa
ataccacagaaagatgaattattatgtcaaaactcagatgatttgaatattataattaat
tcgactactaaaggtggcaatgacaaaacggaagatagtcctgttcggaatttcaataat
caaaataaaaatggagatagcgaagtacaacatcaatcaggatataagtcacttggatgc
atgtctgaattacaaacatcacgtttatataataaattggaattacctgaactatgttcc
gatttaaaagcaaaagtaagagcaggaaaacaatatatatcaaatgatccatatactcaa
aaacaaatattatcaaattatccaaacatgtcttacgaaaacaaatttcaaatccaagaa
atatttcatgataagtatgcatcacctatagcttttgaaatcaaaataggaattgtattt
ttatctagacaatccccaggtgctatgaatgtattatgtggtttatacagacgtttaaaa
ttgttaaaaggtgtttgtatagcattttatggattatatggcttattaaataataagtac
ataatcataaatgatgaaaacattgctaagcatttaaatcaaggtggtttagaattaaca
ggaaattcaccagaacattcattatttgatgaagagaatagaaataaagtttgtgaaact
gtatctaagttacaattaaatggtttggtaatgcctggttcaaatgtgaccataacagaa
gccgcattattagctgaatactttttagaaaaaaaaattcatacatctgttgttggaata
ccattaacgggttctaataatttgattcatgaattaattgaaacatgtgttggttttgat
agtagtacaaaagtttatgcatcattaattggtaatgttcttacagatgcagtcagtatg
cctaaatactggcatttcattcgattaatgggtcgttcaccatctcatgaagtattagaa
tgtgcattacaaacgcatccaaatatggttatcatagctgaagaatatggagcagctgat
aaaacactatggagagttgttcaagatatagctgatgtaatatgtgctagagcagaatta
ggaaagaattatggaacagttctaattccagatgcactattaatgcacttaccacatatg
aaaatattattaacagaaataagtgatatactaaatgaagcatcggaaaaaggagaagta
atacaagcaagaaatgatttagttaatttgtcaaatgaaaaaattgaaaaagaatcacca
tggatagcaaaattaacaccatggagtttagcattaatcaaaacattcccacaatttatt
attaaagaattattacatgttgatttaagatctatgcgttttgaaaaattagaaactgaa
caattattattacaaatggttaaagaagaattacatcaaagaaaagcaaaaggaaaatat
tccggagtgtttatggggttaacccattttttcggttatcaaggacgttcttcattacct
tcagagttcgattgtaagttagcatatgcatatggtcatgcagcttcaattgttattgaa
agtggattaacaggttatatagtatctataagaggtttatgtggtaatgttaatgattgg
aaattatttgcaattccatttatttctcttatgaaaatactattaagaggacaaggaagt
aaatcattaaagagtgcatccaaaggtgatttacccgtcattcctagtgcccctgttgat
ttaaacggaaaagcatatagaagtttaaaaattgctttacaaaaatggcaaatggaagat
agttcttgtaatcctggtccaata

DBGET integrated database retrieval system