KEGG   Plasmodium chabaudi: PCHAS_081670Help
Entry
PCHAS_081670      CDS       T01108                                 

Gene name
PC000906.02.0
Definition
(RefSeq) 6-phosphofructokinase, putative
  KO
K00895  
diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCHAS_081670 (PC000906.02.0)
   00030 Pentose phosphate pathway
    PCHAS_081670 (PC000906.02.0)
   00051 Fructose and mannose metabolism
    PCHAS_081670 (PC000906.02.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PCHAS_081670 (PC000906.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
8
AA seq 1306 aa AA seqDB search
MEKHREKESNPSQVKDTEMLNCLMQKLTSKNFLEEKETKNRFYLVENKDVKIKKLKEHGH
SASLNDNLSPLQYERIKYKPTLPKALASEYQILDEDFGDEFINKKEYEEIKKFFKSIDGL
PMINVKETKNNESFKGGNILKIGIILSGGPAPGGHNVISGIYDYAKRYNEESQVIGFLGG
IDGLYNKNYVTITDNLMNKFRNLGGFNMLWSGRGKVKNKDDLLAIENIVLKLKLNGLVII
GGDGSNSNAALISEYLKERNVPISVIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGN
LCTDVKTGNNVYHVVRVMGRSASHVVLECALQTRPNVVLIGEEVERDKIPLKTIVSNIVN
IILKRHDLNKDYGVILLPEGLIEFIPEMKILIEELNIILKTSDRSEPFDPSKLKESKELW
NFLPQIIRDQLLLDRESTGYIQVGKVATERLIINLVESELAKLKDVNLNIHFMAHYLGYE
GRCALPSNFDCNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHVC
KDNLGKEYPAVKKYLVDLNSPLFKVLKEVQNLWSLYDLYRSPGPIQFNGYLSNYRCYTVK
IPQKDELLCQNSDDLNIIINSTTKGGNDKTEDSPVCGISNNQNKNGDSEVQHQSGYKSLG
CMSELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPNMSYENKFQIQ
EIFHDKYASPIAFEIKIGIVFLSRQSPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLNNK
YIIINDENIAKHLNQGGLELTGNSPEHSLFDEENRNKVCETVSKLQLNGLVMPGSNVTIT
EAALLAEYFLEKKIHTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVS
MPKYWHFIRLMGRSPSHEVLECALQTHPNMVIIAEEYGAADKTLWRVVQDIADVICARAE
LGKNYGTVLIPDALLMHLPHMKILLTEISDILNEASEKGEVIQARNDLVNLSNEKIEKES
PWIAKLTPWSLALIKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKAKGK
YSGVFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVND
WKLFAIPFISLMKILLRGQGSKSLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQME
DSSCNPGPIQFEGNASNYYNRTLFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNV
FVQLCGMLVMAYKPNDILQSMPSIGSIEDYYDWEHQRKTENNKKFI
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcatagagagaaagaaagtaaccctagtcaagttaaagacacagagatgtta
aattgtttgatgcaaaagttaacttcaaaaaattttttagaagaaaaagaaacaaaaaat
cgattttatttagtagaaaataaggatgtaaaaataaaaaaattaaaagaacatggtcat
tcagcatctttaaatgataatctaagtccattacaatatgaaaggataaaatataaacct
acattacctaaggccttagcaagtgaatatcaaatattagatgaagattttggagatgag
tttataaataaaaaagaatacgaagaaataaaaaaattttttaaaagtatagatggttta
ccaatgataaatgtaaaagaaacaaaaaataatgaatcatttaaaggtggaaatatatta
aaaattggtattatattatctggaggtccagcaccaggaggacataatgttatatcaggt
atttatgattatgcaaaacgatataatgaagaatctcaagttattggatttttaggaggt
atagatggtttatataataaaaattatgtaacaataacagataacttaatgaataagttt
cgtaatttaggtggttttaatatgttatggtcaggtagaggtaaagttaaaaataaagat
gatttgctagctattgaaaatattgttttaaaattaaaattaaacggtttagtaattata
ggaggtgatggctcaaatagtaatgccgcattaatttctgaatatcttaaagaaagaaat
gttcctatctctgttataggtgtacccaaaacaattgatggtgatttaaagagtgaagca
attgaaataagttttggatttgataccgcaactagaacctattctgaaataataggaaat
ttatgtacagatgtaaaaacaggaaataatgtttatcatgttgttcgagttatgggacga
tctgcttcacatgttgtgctcgaatgtgcattacaaacaagaccaaatgttgtattgatt
ggtgaagaagtcgaaagagataaaataccactaaaaactattgtaagtaatattgttaat
ataatattaaaaagacatgatttaaataaagattatggtgtaattttattaccagagggg
ttaatagaatttatacccgaaatgaaaatattaattgaagaattaaatattattttaaaa
acatcggatcgatcggaaccatttgatccatctaaattaaaagaatcaaaagaattatgg
aatttcttaccacaaataattagggaccaattgttattagatagagaatcaactggttat
atacaagttggaaaagttgcaacagaaagattaataataaatttagttgaatccgaatta
gctaaattaaaagatgttaatttgaatattcattttatggcccattacttaggatatgaa
ggtagatgtgcattaccatcaaattttgattgtaactattgttattcattaggatataat
gctgcattattaattgatcataagaaaactggttacatgtcaatcatacgaaatttgaaa
aattcttatgaagattggatacccgctggtattccatttttaagaataatgcatgtatgt
aaagacaatttaggaaaagaatatccagctgtcaaaaaatacttagtagacttaaatagc
ccattatttaaagttttaaaagaagttcaaaatttatggtcgttatatgatttatataga
tcaccaggaccaatacaattcaatggctatttaagtaactacagatgttatactgttaaa
ataccacagaaagatgaattattatgtcaaaactcagatgatttgaatattataattaat
tcgactactaaaggtggcaatgacaaaacggaagatagtcctgtttgcggaatttcaaat
aatcaaaataaaaatggagatagcgaagtacaacatcaatcaggatataagtcacttgga
tgcatgtctgaattacaaacatcacgtttatataataaattggaattacctgaactatgt
tccgatttaaaagcaaaagtaagagcaggaaaacaatatatatcaaatgatccatatact
caaaaacaaatattatcaaattatccaaacatgtcttacgaaaacaaatttcaaatccaa
gaaatatttcatgataagtatgcatcacctatagcttttgaaatcaaaataggaattgta
tttttatctagacaatccccaggtgctatgaatgtattatgtggtttatacagacgttta
aaattgttaaaaggtgtttgtatagcattttatggattatatggcttattaaataataag
tacataatcataaatgatgaaaacattgctaagcatttaaatcaaggtggtttagaatta
acaggaaattcaccagaacattcattatttgatgaagagaatagaaataaagtttgtgaa
actgtatctaagttacaattaaatggtttggtaatgcctggttcaaatgtgaccataaca
gaagccgcattattagctgaatactttttagaaaaaaaaattcatacatctgttgttgga
ataccattaacgggttctaataatttgattcatgaattaattgaaacatgtgttggtttt
gatagtagtacaaaagtttatgcatcattaattggtaatgttcttacagatgcagtcagt
atgcctaaatactggcatttcattcgattaatgggtcgttcaccatctcatgaagtatta
gaatgtgcattacaaacgcatccaaatatggttatcatagctgaagaatatggagcagct
gataaaacactatggagagttgttcaagatatagctgatgtaatatgtgctagagcagaa
ttaggaaagaattatggaacagttctaattccagatgcactattaatgcacttaccacat
atgaaaatattattaacagaaataagtgatatactaaatgaagcatcggaaaaaggagaa
gtaatacaagcaagaaatgatttagttaatttgtcaaatgaaaaaattgaaaaagaatca
ccatggatagcaaaattaacaccatggagtttagcattaatcaaaacattcccacaattt
attattaaagaattattacatgttgatttaagatctatgcgttttgaaaaattagaaact
gaacaattattattacaaatggttaaagaagaattacatcaaagaaaagcaaaaggaaaa
tattccggagtgtttatggggttaacccattttttcggttatcaaggacgttcttcatta
ccttcagagttcgattgtaagttagcatatgcatatggtcatgcagcttcaattgttatt
gaaagtggattaacaggttatatagtatctataagaggtttatgtggtaatgttaatgat
tggaaattatttgcaattccatttatttctcttatgaaaatactattaagaggacaagga
agtaaatcattaaagagtgcatccaaaggtgatttacccgtcattcctagtgcccctgtt
gatttaaacggaaaagcatatagaagtttaaaaattgctttacaaaaatggcaaatggaa
gatagttcttgtaatcctggtccaatacaatttgaaggaaatgcttctaactattataat
agaaccctatttgaagaacaatcagaatattttgaaatgttaagatatgtagaatgttat
gcaaatatattaaaagatacatgtagatttggtgtatctgctgattatttaaaaaatgtt
tttgttcaattatgtggtatgcttgttatggcatataaaccaaatgacatattacaaagt
atgccctctataggaagtattgaagattactatgattgggaacatcaaagaaaaactgaa
aacaataaaaaatttatttaa

DBGET integrated database retrieval system