KEGG   Plasmodium chabaudi: PC000907.01.0Help
Entry
PC000907.01.0     CDS       T01108                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcb  Plasmodium chabaudi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pcb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pcb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pcb00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 407 aa AA seqDB search
KQLIYNGNNVKKALFNAEFRQLVNNYITCKRHFSIDTLKVPRLGDSITEGVINEWKKKVG
DYVYSDETLAVIDTDKVSVDINSKSSGALHKIFAEAGDVVLVDSPLCEIDTSAEPNENDI
RNNAEVDNENKLEASDEIEHKNNDEDIKIKETNINTKNTNENNFAGSSSYQYNNERTEKR
IRMLPMRKRIAERLKESQNTCALLTTFNECDMSKAILLRTELKDIFQKKYGCKLGFVSLF
LYASTLALKKMPQVNAYIDNDEIVYKNYIDISVAVATPNGLTVPVIRDCQNKNLPQLELA
LSDLAAKAKNNKLSLDEFTGGTFTISNGGVFGSMLSTPIINMPQSAILGMHTIKDRPVVV
NNEIVIRPVMYLALTYDHRLLDGREAVQFLCTIKDYIENPNLMLIDS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
aagcaactgatttataatgggaataacgtcaagaaagctctttttaatgcggaatttaga
caacttgtaaataattatataacatgtaaaagacatttttccatagacacgttaaaggtg
cccagattgggtgattcaattactgaaggtgttataaatgaatggaaaaaaaaagttggt
gattacgtatattcagatgagacattagcagttattgatacagacaaagttagtgttgat
ataaattcgaaatcgtctggagcattacataaaatctttgctgaagcgggcgacgtagtt
ttagtcgattctcctttatgtgaaattgacacttcggcagaaccaaatgaaaatgatata
aggaataacgccgaagtagataatgaaaacaaattagaagctagtgatgaaatagagcat
aaaaataatgatgaagatataaaaattaaagaaactaatataaacacaaaaaacacaaat
gaaaataattttgcaggatcatcatcctatcaatataataatgaaaggactgaaaaacga
atccgtatgttaccaatgagaaaacgaattgcagaaagattaaaggaatcacaaaataca
tgtgctttattaacaacatttaatgaatgtgatatgagtaaagcaatacttttaagaacc
gaattaaaagatatttttcaaaaaaaatatggatgtaaattagggtttgtatcattattt
ttatatgcatcaacattagctttaaaaaaaatgccacaagttaatgcatatattgataat
gatgaaattgtatataaaaattatatagacatatcagtagctgtagctacacctaatggt
ttaacagttccagttattcgagattgccaaaataaaaacttaccacaattagaattagct
ttatcagatctagctgcaaaagctaaaaataataaactatcattagatgaatttacagga
ggtacatttacaatatcgaatggtggtgtatttggtagtatgctaagtacccctattatt
aatatgccacaatcagccatattaggtatgcacacaataaaagataggccagtagttgtt
aataatgaaattgttattaggcctgttatgtatttagccttaacttatgatcatagatta
ttggatggaagagaagccgtacaatttttatgtacaataaaggattatatcgaaaatcca
aatcttatgttaatagacagttaa

DBGET integrated database retrieval system