KEGG   Plasmodium chabaudi: PCHAS_142090Help
Entry
PCHAS_142090      CDS       T01108                                 

Gene name
PC000907.01.0
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, putative
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcb  Plasmodium chabaudi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCHAS_142090 (PC000907.01.0)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCHAS_142090 (PC000907.01.0)
  Amino acid metabolism
   00310 Lysine degradation
    PCHAS_142090 (PC000907.01.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PCHAS_142090 (PC000907.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 417 aa AA seqDB search
MNQTLINRLNKQLIYNGNNVKKALFNAEFRQLVNNYITCKRHFSIDTLKVPRLGDSITEG
VINEWKKKVGDYVYSDETLAVIDTDKVSVDINSKSSGALHKIFAEAGDVVLVDSPLCEID
TSAEPNENDIRNNAEVDNENKLEASDEIEHKNNDEDIKIKETNINTKNTNENNFAGSSSY
QYNNERTEKRIRMLPMRKRIAERLKESQNTCALLTTFNECDMSKAILLRTELKDIFQKKY
GCKLGFVSLFLYASTLALKKMPQVNAYIDNDEIVYKNYIDISVAVATPNGLTVPVIRDCQ
NKNLPQLELALSDLAAKAKNNKLSLDEFTGGTFTISNGGVFGSMLSTPIINMPQSAILGM
HTIKDRPVVVNNEIVIRPVMYLALTYDHRLLDGREAVQFLCTIKDYIENPNLMLIDS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactcttataaatcgcctgaataagcaactgatttataatgggaataacgtc
aagaaagctctttttaatgcggaatttagacaacttgtaaataattatataacatgtaaa
agacatttttccatagacacgttaaaggtgcccagattgggtgattcaattactgaaggt
gttataaatgaatggaaaaaaaaagttggtgattacgtatattcagatgagacattagca
gttattgatacagacaaagttagtgttgatataaattcgaaatcgtctggagcattacat
aaaatctttgctgaagcgggcgacgtagttttagtcgattctcctttatgtgaaattgac
acttcggcagaaccaaatgaaaatgatataaggaataacgccgaagtagataatgaaaac
aaattagaagctagtgatgaaatagagcataaaaataatgatgaagatataaaaattaaa
gaaactaatataaacacaaaaaacacaaatgaaaataattttgcaggatcatcatcctat
caatataataatgaaaggactgaaaaacgaatccgtatgttaccaatgagaaaacgaatt
gcagaaagattaaaggaatcacaaaatacatgtgctttattaacaacatttaatgaatgt
gatatgagtaaagcaatacttttaagaaccgaattaaaagatatttttcaaaaaaaatat
ggatgtaaattagggtttgtatcattatttttatatgcatcaacattagctttaaaaaaa
atgccacaagttaatgcatatattgataatgatgaaattgtatataaaaattatatagac
atatcagtagctgtagctacacctaatggtttaacagttccagttattcgagattgccaa
aataaaaacttaccacaattagaattagctttatcagatctagctgcaaaagctaaaaat
aataaactatcattagatgaatttacaggaggtacatttacaatatcgaatggtggtgta
tttggtagtatgctaagtacccctattattaatatgccacaatcagccatattaggtatg
cacacaataaaagataggccagtagttgttaataatgaaattgttattaggcctgttatg
tatttagccttaacttatgatcatagattattggatggaagagaagccgtacaattttta
tgtacaataaaggattatatcgaaaatccaaatcttatgttaatagacagttaa

DBGET integrated database retrieval system