KEGG   Plasmodium chabaudi: PC000907.01.0Help
Entry
PC000907.01.0     CDS       T01108                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcb  Plasmodium chabaudi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC000907.01.0
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PC000907.01.0
  Amino acid metabolism
   00310 Lysine degradation
    PC000907.01.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PC000907.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 407 aa AA seqDB search
KQLIYNGNNVKKALFNAEFRQLVNNYITCKRHFSIDTLKVPRLGDSITEGVINEWKKKVG
DYVYSDETLAVIDTDKVSVDINSKSSGALHKIFAEAGDVVLVDSPLCEIDTSAEPNENDI
RNNAEVDNENKLEASDEIEHKNNDEDIKIKETNINTKNTNENNFAGSSSYQYNNERTEKR
IRMLPMRKRIAERLKESQNTCALLTTFNECDMSKAILLRTELKDIFQKKYGCKLGFVSLF
LYASTLALKKMPQVNAYIDNDEIVYKNYIDISVAVATPNGLTVPVIRDCQNKNLPQLELA
LSDLAAKAKNNKLSLDEFTGGTFTISNGGVFGSMLSTPIINMPQSAILGMHTIKDRPVVV
NNEIVIRPVMYLALTYDHRLLDGREAVQFLCTIKDYIENPNLMLIDS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
aagcaactgatttataatgggaataacgtcaagaaagctctttttaatgcggaatttaga
caacttgtaaataattatataacatgtaaaagacatttttccatagacacgttaaaggtg
cccagattgggtgattcaattactgaaggtgttataaatgaatggaaaaaaaaagttggt
gattacgtatattcagatgagacattagcagttattgatacagacaaagttagtgttgat
ataaattcgaaatcgtctggagcattacataaaatctttgctgaagcgggcgacgtagtt
ttagtcgattctcctttatgtgaaattgacacttcggcagaaccaaatgaaaatgatata
aggaataacgccgaagtagataatgaaaacaaattagaagctagtgatgaaatagagcat
aaaaataatgatgaagatataaaaattaaagaaactaatataaacacaaaaaacacaaat
gaaaataattttgcaggatcatcatcctatcaatataataatgaaaggactgaaaaacga
atccgtatgttaccaatgagaaaacgaattgcagaaagattaaaggaatcacaaaataca
tgtgctttattaacaacatttaatgaatgtgatatgagtaaagcaatacttttaagaacc
gaattaaaagatatttttcaaaaaaaatatggatgtaaattagggtttgtatcattattt
ttatatgcatcaacattagctttaaaaaaaatgccacaagttaatgcatatattgataat
gatgaaattgtatataaaaattatatagacatatcagtagctgtagctacacctaatggt
ttaacagttccagttattcgagattgccaaaataaaaacttaccacaattagaattagct
ttatcagatctagctgcaaaagctaaaaataataaactatcattagatgaatttacagga
ggtacatttacaatatcgaatggtggtgtatttggtagtatgctaagtacccctattatt
aatatgccacaatcagccatattaggtatgcacacaataaaagataggccagtagttgtt
aataatgaaattgttattaggcctgttatgtatttagccttaacttatgatcatagatta
ttggatggaagagaagccgtacaatttttatgtacaataaaggattatatcgaaaatcca
aatcttatgttaatagacagttaa

DBGET integrated database retrieval system