KEGG   Plasmodium chabaudi: PCHAS_142090Help
Entry
PCHAS_142090      CDS       T01108                                 

Gene name
PC000907.01.0
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00020  Citrate cycle (TCA cycle)
pcb00310  Lysine degradation
pcb01100  Metabolic pathways
pcb01110  Biosynthesis of secondary metabolites
pcb01130  Biosynthesis of antibiotics
pcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCHAS_142090 (PC000907.01.0)
  Amino acid metabolism
   00310 Lysine degradation
    PCHAS_142090 (PC000907.01.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PCHAS_142090 (PC000907.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 3496782
NCBI-ProteinID: XP_016654887
UniProt: A0A077TSS4
Position
14
AA seq 417 aa AA seqDB search
MNQTLINRLNKQLIYNGNNVKKALFNAEFRQLVNNYITCKRHFSIDTLKVPRLGDSITEG
VINEWKKKVGDYVYSDETLAVIDTDKVSVDINSKSSGALHKIFAEAGDVVLVDSPLCEID
TSAEPNENDIRNNAEVDNENKLEASDEIEHKNNDEDIKIKETNINTKNTNENNFAGSSSY
QYNNERTEKRIRMLPMRKRIAERLKESQNTCALLTTFNECDMSKAILLRTELKDIFQKKY
GCKLGFVSLFLYASTLALKKMPQVNAYIDNDEIVYKNYIDISVAVATPNGLTVPVIRDCQ
NKNLPQLELALSDLAAKAKNNKLSLDEFTGGTFTISNGGVFGSMLSTPIINMPQSAILGM
HTIKDRPVVVNNEIVIRPVMYLALTYDHRLLDGREAVQFLCTIKDYIENPNLMLIDS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactcttataaatcgcctgaataagcaactgatttataatgggaataacgtc
aagaaagctctttttaatgcggaatttagacaacttgtaaataattatataacatgtaaa
agacatttttccatagacacgttaaaggtgcccagattgggtgattcaattactgaaggt
gttataaatgaatggaaaaaaaaagttggtgattacgtatattcagatgagacattagca
gttattgatacagacaaagttagtgttgatataaattcgaaatcgtctggagcattacat
aaaatctttgctgaagcgggcgacgtagttttagtcgattctcctttatgtgaaattgac
acttcggcagaaccaaatgaaaatgatataaggaataacgccgaagtagataatgaaaac
aaattagaagctagtgatgaaatagagcataaaaataatgatgaagatataaaaattaaa
gaaactaatataaacacaaaaaacacaaatgaaaataattttgcaggatcatcatcctat
caatataataatgaaaggactgaaaaacgaatccgtatgttaccaatgagaaaacgaatt
gcagaaagattaaaggaatcacaaaatacatgtgctttattaacaacatttaatgaatgt
gatatgagtaaagcaatacttttaagaaccgaattaaaagatatttttcaaaaaaaatat
ggatgtaaattagggtttgtatcattatttttatatgcatcaacattagctttaaaaaaa
atgccacaagttaatgcatatattgataatgatgaaattgtatataaaaattatatagac
atatcagtagctgtagctacacctaatggtttaacagttccagttattcgagattgccaa
aataaaaacttaccacaattagaattagctttatcagatctagctgcaaaagctaaaaat
aataaactatcattagatgaatttacaggaggtacatttacaatatcgaatggtggtgta
tttggtagtatgctaagtacccctattattaatatgccacaatcagccatattaggtatg
cacacaataaaagataggccagtagttgttaataatgaaattgttattaggcctgttatg
tatttagccttaacttatgatcatagattattggatggaagagaagccgtacaattttta
tgtacaataaaggattatatcgaaaatccaaatcttatgttaatagacagttaa

DBGET integrated database retrieval system