KEGG   Plasmodium chabaudi: PC000948.01.0Help
Entry
PC000948.01.0     CDS       T01108                                 

Definition
Histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PC000948.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 447 aa AA seqDB search
MSNRKKVAYFHDPDIGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNEL
TLFHDYEYIDFLSSISMENYRDFTYQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAA
KLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILELLKYHARVMYIDIDVHHGDG
VEEAFYVTHRVMTVSFHKFGDYFPGTGDITDVGVNHGKYYSVNVPLNDGITDEAFVDLFK
VVIDKCVQSYKPGAIILQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNLPLLVLGGGG
YTIRNVSRCWAYETGVVLNKHHEMSDQISLNDYYDYYAPDFQLHLQPSSIPNYNSPEHLS
KIKMKIAENLRNIEHAPGVQFSYVPPDFFDSDIDDKSDKNQYELKDDSGGGRAAGTRGKE
HSSSHHLRRKNYEDDFFDMSDRDQGII
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataggaaaaaagtagcatatttccatgaccctgatataggtagctattattat
ggagcgggtcatcctatgaagcctcaaagaattcgaatgacacattcgttaattgtatca
tacaatttatataaatatatggaagtatataggcctcataaaagtgatgtgaatgagtta
actttatttcatgattatgaatatattgattttttatcatcaatatctatggaaaattat
cgagatttcacataccaattaaaaagatttaatgttggagaagctactgattgcccagtt
tttgatggcctttttcaatttcagcaatcctgcgcaggtgcatcgattgatggcgcagcg
aaattaaatcaccattgtgccgatatttgcgtgaactggtcaggtggtttacatcatgca
aaaatgtcagaagctagtggtttttgttatattaatgacattgttttaggaatattagaa
cttttaaaatatcatgcacgtgtcatgtatattgacatcgatgttcatcatggggatgga
gttgaagaagctttttatgttactcatagagttatgactgtatcatttcataaatttggt
gactactttcctggtacaggtgatataacagatgttggagttaatcatggaaagtactat
agtgttaatgtgccattaaatgatggaataacagatgaagcatttgtggatttatttaaa
gttgttatagataaatgtgtccagtcttataagcctggtgctattatacttcaatgtgga
gccgatagtttaacgggtgatagattaggcagatttaatttaacgataaaaggtcatgca
agatgtgttgagcatgttcgttcatataatttgccattattagttttaggtggtggagga
tatacaatacgtaatgtatcaagatgttgggcatatgaaactggagttgttttaaataaa
catcatgaaatgtctgatcaaattagcttaaatgattattatgattattatgcacctgat
tttcaattacatttacagccatctagtataccaaattataattcacctgaacatttaagt
aaaattaaaatgaaaatagcagaaaacttaaggaatattgagcatgctccaggtgtccaa
ttttcttatgtaccacctgactttttcgattcagatatagacgataaaagtgataaaaat
cagtacgaacttaaagatgatagtggaggtggtagagcagcaggaacaagaggaaaagaa
cattcatcgagccatcatctaaggcgaaaaaattatgaagatgatttcttcgatatgtca
gatagagatcaaggaattatttag

DBGET integrated database retrieval system