KEGG   Plasmodium chabaudi: PC001036.02.0Help
Entry
PC001036.02.0     CDS       T01108                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PC001036.02.0
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   PC001036.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MQNDDSTYIDSNEEEKNGEYINDNTNENIKNNDNINKKYGEKEYNASETKKNDNNERTKN
NSNNKTGKIKDGNKKNEKGKDEKINIKEAIIKNVRVPANYVIKHLIGRGSYGYVYLAYDK
NTERNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLYDLIIPEDLLKFDELYIV
LEIADSDLKKLFKTPIFLTEEHIKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSV
KVCDFGLARTINNEKDVNIVNDLEENEEPGPHNKNLKKQLTSHVVTRWYRAPELILLQEN
YTKSIDIWSTGCIFAELLNMLQSHISDPTNRFPLFPGSSCFPLSPDRNSKKVHEKSNRDQ
LNIIFNIIGTPTEDDLKNISKPEVIKYIKLFPHRKPTNLKQKYSSISEDGINLLESMLKF
NPNKRITIDQALDHPYLKDVRKKDIENFSTKKIILPFDDWMVLSETQLRYIFLKEVQSFH
PELVIPPAFTIHENIFYNNEEPSS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgatgatagcacatatatagatagcaatgaagaagagaaaaatggggaatac
ataaatgataacacaaatgaaaatataaaaaataacgacaatattaacaaaaaatacggc
gaaaaggaatacaatgcatccgagacaaaaaaaaacgataataacgagagaaccaaaaat
aatagtaacaataaaactggcaaaataaaggatggaaataaaaagaatgagaaaggaaaa
gatgaaaaaataaatataaaagaagctattataaaaaatgtgcgtgtgccagctaattac
gtaatcaaacacttaataggaagagggtcgtatgggtatgtatatttagcttatgataaa
aatacagaaagaaatgttgcaataaaaaaggtcaatcgaatgtttgaagatttaattgat
tgtaaaagaatattaagagaaataacaattttgaatagactaaaaagtgattatattata
agattatatgatttaataatacctgaagatttattaaaattcgatgaattgtatatagta
ttagaaatagccgattcagatttaaaaaaattatttaaaacaccaatatttttgacagaa
gagcatataaaaacaatattatataatttattattaggtgaaaaatttattcatgaatca
ggtattatccatagagatttaaaaccggctaattgtttattaaatcaagattgttctgtt
aaggtatgtgattttggtttagctagaacgataaataatgaaaaagatgttaatatagta
aacgatttagaagaaaatgaagaaccagggccacataataaaaatttaaaaaaacaatta
actagccatgtagttactagatggtatagagcccctgaattaattttgttacaagaaaat
tatactaaatctatagacatatggtctactggttgtatttttgcagaactattaaatatg
ttacaaagccatattagtgatcccactaatagatttcctttatttccggggtcttcttgt
ttccccctatctccagaccgtaattcaaaaaaagtacatgagaaaagtaatagagatcaa
ttaaatattatttttaatatcataggtacacctacagaagatgatcttaaaaatattagc
aaacctgaagttataaaatatattaaattattcccgcatagaaaacctacaaatttaaag
caaaaatactcatctatttcagaagatggaataaatttattagaatcaatgttaaaattt
aatccaaataaaagaatcacaattgaccaagctttagatcatccttatctaaaagatgtt
agaaaaaaagatatagaaaacttctcaacaaaaaaaattattcttccttttgatgattgg
atggttttatcagaaacacaattgagatatatatttttaaaagaagtacaatcctttcat
cccgaattagttatacctcctgcatttactatccacgaaaatattttctataacaatgag
gagcctagcagttaa

DBGET integrated database retrieval system