KEGG   Plasmodium chabaudi: PCHAS_091060Help
Entry
PCHAS_091060      CDS       T01108                                 

Gene name
PC001036.02.0
Definition
(RefSeq) mitogen-activated protein kinase 2, putative
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcb  Plasmodium chabaudi
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    PCHAS_091060 (PC001036.02.0)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PCHAS_091060 (PC001036.02.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PCHAS_091060 (PC001036.02.0)
Protein kinases [BR:pcb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PCHAS_091060 (PC001036.02.0)
Chromosome [BR:pcb03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PCHAS_091060 (PC001036.02.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PCHAS_091060 (PC001036.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 533 aa AA seqDB search
MLKKKKECSGIEREEKNTKKKNNASECLSMQNDDSTYIDSNEEEKNGEYINDNTNENIKN
NDNINKKYGEKEYNASETKKNDNNERTKNNSNNKTGKIKDGNKKNEKGKDEKINIKEAII
KNVRVPANYVIKHLIGRGSYGYVYLAYDKNTERNVAIKKVNRMFEDLIDCKRILREITIL
NRLKSDYIIRLYDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEEHIKTILYNLL
LGEKFIHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINNEKDVNIVNDLEENEEPGP
HNKNLKKQLTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHISDPTNR
FPLFPGSSCFPLSPDRNSKKVHEKSNRDQLNIIFNIIGTPTEDDLKNISKPEVIKYIKLF
PHRKPTNLKQKYSSISEDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKDIENFSTK
KIILPFDDWMVLSETQLRYIFLKEVQSFHPELVIPPAFTIHENIFYNNEEPSS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaaaaagagtgctctggaattgaaagggaagaaaagaatacaaaaaaa
aaaaacaatgcttcagaatgtttaagcatgcaaaatgatgatagcacatatatagatagc
aatgaagaagagaaaaatggggaatacataaatgataacacaaatgaaaatataaaaaat
aacgacaatattaacaaaaaatacggcgaaaaggaatacaatgcatccgagacaaaaaaa
aacgataataacgagagaaccaaaaataatagtaacaataaaactggcaaaataaaggat
ggaaataaaaagaatgagaaaggaaaagatgaaaaaataaatataaaagaagctattata
aaaaatgtgcgtgtgccagctaattacgtaatcaaacacttaataggaagagggtcgtat
gggtatgtatatttagcttatgataaaaatacagaaagaaatgttgcaataaaaaaggtc
aatcgaatgtttgaagatttaattgattgtaaaagaatattaagagaaataacaattttg
aatagactaaaaagtgattatattataagattatatgatttaataatacctgaagattta
ttaaaattcgatgaattgtatatagtattagaaatagccgattcagatttaaaaaaatta
tttaaaacaccaatatttttgacagaagagcatataaaaacaatattatataatttatta
ttaggtgaaaaatttattcatgaatcaggtattatccatagagatttaaaaccggctaat
tgtttattaaatcaagattgttctgttaaggtatgtgattttggtttagctagaacgata
aataatgaaaaagatgttaatatagtaaacgatttagaagaaaatgaagaaccagggcca
cataataaaaatttaaaaaaacaattaactagccatgtagttactagatggtatagagcc
cctgaattaattttgttacaagaaaattatactaaatctatagacatatggtctactggt
tgtatttttgcagaactattaaatatgttacaaagccatattagtgatcccactaataga
tttcctttatttccggggtcttcttgtttccccctatctccagaccgtaattcaaaaaaa
gtacatgagaaaagtaatagagatcaattaaatattatttttaatatcataggtacacct
acagaagatgatcttaaaaatattagcaaacctgaagttataaaatatattaaattattc
ccgcatagaaaacctacaaatttaaagcaaaaatactcatctatttcagaagatggaata
aatttattagaatcaatgttaaaatttaatccaaataaaagaatcacaattgaccaagct
ttagatcatccttatctaaaagatgttagaaaaaaagatatagaaaacttctcaacaaaa
aaaattattcttccttttgatgattggatggttttatcagaaacacaattgagatatata
tttttaaaagaagtacaatcctttcatcccgaattagttatacctcctgcatttactatc
cacgaaaatattttctataacaatgaggagcctagcagttaa

DBGET integrated database retrieval system