KEGG   Plasmodium chabaudi: PC001056.02.0Help
Entry
PC001056.02.0     CDS       T01108                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PC001056.02.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PC001056.02.0
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PC001056.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MNVILSIDQSTQSTKLIFFDEGLKVLHMNSLNHEQKCFKPGWYEHDPEEIIDNLYKLMNE
GMTVLKEKYQNVVIKCIGITNQRETVIIWDKETGKPLYNAIVWLDTRVEDLVTEFSKKYN
NDYFQKKTGTYFNTYFSAFKILWLIKNNKTIKEKVKNGTAMIGNINTWVIYNLTKGNCYT
DVTNASRTLLMDIKTLQWDPEMCKMFGISNMASLPEIKSNCYNFGLVKSENVPEYLNVPI
TGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLVNTGNKIVYSSCGLITTVCYKFNDDDK
PNYALEGSIGTAGSGVSWLENVNLVKDTSEVSDIMETCKDTEGVVFVPAFGGLFAPRWRS
DARACISGMSFNTSRAHIV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaatattaagtatagaccaaagtactcagtccacgaagttgatcttctttgat
gaaggattaaaggtgctgcatatgaacagcttaaaccatgagcaaaaatgttttaagcct
ggttggtatgaacatgatccagaggaaataattgataatttatataaactaatgaatgaa
ggaatgactgttttaaaagagaaatatcaaaatgttgtaataaaatgtataggtattact
aaccaaagagaaactgttataatatgggataaagagactggtaaacctttatacaatgca
atagtatggctagatacaagagtagaagatcttgttacggaattttctaaaaagtataat
aatgattattttcagaaaaaaacgggtacctattttaatacctattttagtgcttttaaa
atattatggttaataaaaaataataaaactataaaggaaaaggtaaaaaatggtacagct
atgattggaaatataaatacatgggtgatttataatttaactaaaggtaattgttataca
gatgtaacaaatgcatctagaacccttttaatggatatcaaaacattacaatgggaccca
gaaatgtgtaaaatgtttggtattagtaatatggcttctttacccgaaataaaaagtaat
tgttataatttcggtttagtaaaatcagaaaatgtgcctgagtatttaaacgttccaatt
actggttgtataggtgaccaacaaagtgcatgtataggtcaggcaatttttgatgaagga
gaagcaaagtgtacatatggaactggtgttttcttattagttaatacaggaaataaaatt
gtatattcttcttgtggattaatcacaacagtttgttataaatttaacgatgatgataaa
ccaaactatgctcttgaaggttcaataggtacagctggatccggtgtatcatggttagaa
aatgttaatttagttaaagacacatctgaagtaagtgatattatggaaacttgtaaagac
actgaaggagttgtatttgttccagcttttggtggtttatttgctccaagatggagatca
gatgctagagcatgtataagtggtatgtcttttaatacaagcagggctcatattgtt

DBGET integrated database retrieval system