KEGG   Plasmodium chabaudi: PC001056.02.0Help
Entry
PC001056.02.0     CDS       T01108                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pcb00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MNVILSIDQSTQSTKLIFFDEGLKVLHMNSLNHEQKCFKPGWYEHDPEEIIDNLYKLMNE
GMTVLKEKYQNVVIKCIGITNQRETVIIWDKETGKPLYNAIVWLDTRVEDLVTEFSKKYN
NDYFQKKTGTYFNTYFSAFKILWLIKNNKTIKEKVKNGTAMIGNINTWVIYNLTKGNCYT
DVTNASRTLLMDIKTLQWDPEMCKMFGISNMASLPEIKSNCYNFGLVKSENVPEYLNVPI
TGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLVNTGNKIVYSSCGLITTVCYKFNDDDK
PNYALEGSIGTAGSGVSWLENVNLVKDTSEVSDIMETCKDTEGVVFVPAFGGLFAPRWRS
DARACISGMSFNTSRAHIV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaatattaagtatagaccaaagtactcagtccacgaagttgatcttctttgat
gaaggattaaaggtgctgcatatgaacagcttaaaccatgagcaaaaatgttttaagcct
ggttggtatgaacatgatccagaggaaataattgataatttatataaactaatgaatgaa
ggaatgactgttttaaaagagaaatatcaaaatgttgtaataaaatgtataggtattact
aaccaaagagaaactgttataatatgggataaagagactggtaaacctttatacaatgca
atagtatggctagatacaagagtagaagatcttgttacggaattttctaaaaagtataat
aatgattattttcagaaaaaaacgggtacctattttaatacctattttagtgcttttaaa
atattatggttaataaaaaataataaaactataaaggaaaaggtaaaaaatggtacagct
atgattggaaatataaatacatgggtgatttataatttaactaaaggtaattgttataca
gatgtaacaaatgcatctagaacccttttaatggatatcaaaacattacaatgggaccca
gaaatgtgtaaaatgtttggtattagtaatatggcttctttacccgaaataaaaagtaat
tgttataatttcggtttagtaaaatcagaaaatgtgcctgagtatttaaacgttccaatt
actggttgtataggtgaccaacaaagtgcatgtataggtcaggcaatttttgatgaagga
gaagcaaagtgtacatatggaactggtgttttcttattagttaatacaggaaataaaatt
gtatattcttcttgtggattaatcacaacagtttgttataaatttaacgatgatgataaa
ccaaactatgctcttgaaggttcaataggtacagctggatccggtgtatcatggttagaa
aatgttaatttagttaaagacacatctgaagtaagtgatattatggaaacttgtaaagac
actgaaggagttgtatttgttccagcttttggtggtttatttgctccaagatggagatca
gatgctagagcatgtataagtggtatgtcttttaatacaagcagggctcatattgtt

DBGET integrated database retrieval system