KEGG   Plasmodium chabaudi: PC001064.02.0Help
Entry
PC001064.02.0     CDS       T01108                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PC001064.02.0
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PC001064.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1824 aa AA seqDB search
PNICIFLLKRFTFDLNKMETVKLNNKFEFYKELDLSKYCKDSEQKYILQAVSVHQGNMNS
GHYYSFSYKHDEKFWLKCDDDKIYRVSEHSVINDNFGGYDIEIENNMYNFDICDRIKQRM
KNYSAYMLVYVKKSLIPKLIKECDPAIVNPQVVRRCKLEEIINKKRTKLKQDILQYVKIK
VYDKYSYVYKSFSGLPPNNIPSLFSTKFNKNKTLSDIFFQILKIIKNIYTRKKNKQLMHH
SKCHLKSNKKQKITSSNLNSSNPMDNNLTHQSKQTIMNNPNDSILMSPEMNTTDLSNSIN
YQMSNNTINSNNKTHIKMEQLEEKRYNGNCNDSNFVNNRTTDLMMKTQFSKTGIIQTKDE
FDNIIENVNNQSDTSLSTNSSVPSGCTTTTLDNYIKYISKKQKFETEKRSSKSNRIKHKK
TTKKKKKIKKQNDKITKRPKKEKHLQNPSSSHYSRFRSNSSYDSEDTASNSFASNDSSHI
SNSDHFSDSGNTSTNSASNTTTTSPSASASSSSSSFTSTSSSSQFTSYCYPSKRNCFFVL
LPVNDTYRYLPLDLKNNGKLYLYELLKKTSRESNDLFPTIDILYLPYNKRTAVSGSSSSK
NKNILLFLKYFDIYNEEKINDSSLVCLDVMHCDINLKPKYLETRMINKILKAMDKNFVIK
NNYNILKEYIQNINNNELYSDESPNFKIFVEYKNKCNLIKQKKSIAHNKIITSDLLIFNF
ISNNDLEKKKKIILSLGNKKQDLYITKENISSYDLFLNANLNKILYRISKLIHQNSSNIH
YIICNRNGIFYKINDDQNNISLTHQDLEQDNGSYPNPNNLCQDININYFEKINENVVNTN
ENMLYQNSMQSLNNNKDEMNVNPNLIHPYNDKNNISNFSEISKSTLFKKTSENNKPTQNY
DLTNFNILDNNDDNLNDNEINSLYLCLKKYSKNSEQNNIFYEYSLIDQNLADKLDQLIIN
NNHHILKEKKKYNIINPEAILHNTQNLFSIESKNICRDYQYPFYSPHSSDLSSDELDTAD
CNNKMASYSENHLKKKKKKNRKNKQNSSQPTIDETYKHPNNINYCDSNLILPKVEKNVIN
TANLGSHTIKKAHCYYYNSRKSDDINDSLETLNESNITTILMSNENTTSNELIDVNYSDI
SSRSSANSVLTYTSESTDYYLDNVEEELEESIYTTRIYDLKKEAKRVRRNSKKKINDFTN
IKSQDDQYKITTDEQLYEKNINQNTEYPHNNLYNNPEAKNDSIYNMESQLANTHYEKNIQ
IKAIDNVSKVNEQIGDPNNIGINSIPNNTTIPIDADSIKDRTHSYNNAIPEMKNYNNDTN
ENDKTTTPHTEIDHNLKNNNISKKANRIVKKCGGIPSKEEPILPFYVICDYLDFVERKMY
VNRFRFKLYDPIYQLGKYRNCSGVILKSDLKKSCLNYIDSHFLFLKKELCKIDLDIDIRC
PTKQIFKHVCYKMNIDPTHILIYPYPPLNSPINFIPYNIDSFTCPPEHDNDSYHEYSDNM
NSNDPSYTDENTNSASGQISFETLIKQRTMELEHNSLTEQKTFCLSLLPFHYKYFTRLYP
HDSPKYFHYVIQLFNSHVQSVSAFTGHIKLKKSKKKCAIGNDNDSKSNNYYNLDAESIDS
TSSSDNSSSTLANNEYDSNDYTTVQDLIDKIKLEMNPYLKKRGINPKHKFRLLFTFGPKI
KYLNSNEPLIHLDFVKTNHIKNVYVTPLRMEPDFTDQQKQMLEMNQLKIIHVFNQTPSKE
VFGYSFDVLVEPNDTMLEIKNKIRKRTILPKYIFDKITFFEYENGQRIWRSNDIINWNNK
QFAIIIGEHHAPSQSKPQIGMKIA
NT seq 5475 nt NT seq  +upstreamnt  +downstreamnt
ccaaatatttgtatatttttattaaaaagatttacatttgatttaaataaaatggaaaca
gtcaaattaaataataaatttgaattttataaagaattagatttatcaaaatattgtaaa
gatagcgaacaaaaatatattttacaagcagtctcagtacatcaagggaatatgaatagt
gggcattactattcctttagttataaacatgatgaaaagttttggcttaaatgtgatgat
gataaaatatatagagttagtgaacattcagtaataaatgataattttggaggatatgat
atagaaattgaaaataacatgtataattttgatatttgcgataggattaaacaaaggatg
aaaaattatagtgcttatatgttagtatatgttaagaaatctttaataccgaagttaata
aaagaatgtgatcctgctattgttaatcctcaggttgtccgaagatgtaaacttgaagaa
ataattaataaaaaacgaacgaaattaaaacaagatattttacaatatgttaaaataaaa
gtatatgataaatatagttatgtttataaatctttttcaggattaccacccaataatata
ccatcattgttcagtaccaaatttaataaaaataaaaccctttcagatatattttttcaa
attttaaaaataattaaaaatatttatactcgaaaaaaaaacaagcaattaatgcatcac
tctaaatgtcatcttaaatcaaataaaaaacaaaaaattacatcatccaatcttaacagc
tccaacccaatggataataatttgactcaccaaagtaaacaaacaataatgaataatcca
aacgattccattcttatgtcaccagaaatgaatactaccgatttatctaactcgataaat
tatcaaatgtcaaacaatactataaatagtaataataagactcatataaaaatggagcag
cttgaagaaaaaagatataatggtaactgtaacgatagtaattttgttaataatcgaact
accgatttaatgatgaagacacagttttctaaaactggaattattcaaacaaaagatgaa
tttgataatattattgaaaatgtaaataatcaatcagatacaagcttatctacaaattct
tctgttccttctggatgtactacaactactttagataactatattaaatatatttctaaa
aaacaaaaatttgaaactgaaaagagatcatcaaaaagtaatcgaattaaacataaaaaa
acaacaaaaaaaaaaaagaaaattaaaaaacaaaatgataaaataactaaaagaccaaaa
aaagaaaaacatttacaaaatccatcttcttcacattattcaagatttagatctaattca
tcttatgattcagaagatactgcatctaattcatttgcatctaatgattcatcacatatt
tctaattctgatcatttttcagattcaggaaatacatcaacaaatagtgcatctaacact
actactacatcaccttccgcttctgcttcgtcgtcttcctcttcgttcacttcaacttcg
tcatcttcacaatttacttcctattgttatccaagcaagagaaactgtttttttgttcta
ctccctgtgaatgatacatatagatatcttcccctcgatctcaaaaataatggaaagtta
tacctatatgagttacttaaaaagacaagtagagaatcaaatgatttatttccaacaatt
gatatactataccttccttacaataaacgaactgctgtatcaggatctagtagttcgaaa
aataagaatatattactttttttaaaatactttgatatatataatgaagaaaaaattaat
gattcatcgttagtctgtttagatgttatgcattgtgatataaatttaaaaccaaaatat
ttagaaacaaggatgataaataagatactaaaagcaatggataaaaattttgtaataaaa
aataattataatatattaaaagaatacatacaaaatattaataataatgaattatattca
gatgaatcaccaaattttaaaatctttgttgaatataaaaataaatgcaatttaataaaa
caaaaaaaaagtattgcacacaataaaattattactagtgatctcctaatatttaacttt
ataagtaataacgatttagaaaaaaaaaaaaaaattattctatccttaggtaataaaaaa
caagatctatatattactaaagaaaatatatcatcctatgatctatttttaaatgcaaat
ttaaacaaaatattatatagaataagcaaactaattcatcaaaactcatcaaatatacat
tatataatatgcaataggaatggtatattttacaaaattaatgatgatcaaaataatatt
tcactaactcaccaagacctcgaacaagataatggatcataccctaatcctaataactta
tgtcaagatataaacatcaactattttgaaaaaataaatgaaaatgtagtcaatacgaat
gaaaatatgttatatcaaaattcgatgcaatctctaaataataacaaagatgaaatgaat
gttaatccaaatttaattcatccatataatgacaaaaataatatttcaaacttttcagaa
atatctaaatcgactctatttaaaaaaacatcagaaaataataaacctacacaaaactat
gatctaaccaattttaatatattagacaataatgatgataatttaaatgataacgaaata
aatagtttatatttgtgtttaaaaaaatacagtaaaaattctgaacaaaataatattttt
tatgaatatagcttgattgatcagaatttagctgataaattagatcaactcataattaat
aataatcatcatattttgaaagaaaaaaaaaaatataatattataaatcctgaagctatt
ttacacaatactcaaaatttgttttctatagaatcaaaaaatatttgtcgtgattatcaa
tatccattttattcaccacattcatctgatttatcatctgatgaattggatacagctgac
tgtaataataaaatggctagctattctgaaaatcatttaaaaaaaaaaaaaaaaaaaaat
agaaaaaataaacaaaatagctcacaacctactattgatgaaacatacaaacatccaaat
aatataaactattgtgattcaaatttgattcttcctaaggttgaaaaaaatgtaataaat
actgccaatttgggttctcatacaataaaaaaagctcattgttattattataattctaga
aaaagtgatgacataaatgattcattagaaactttaaatgaatctaatattactacaata
ttaatgtcaaatgaaaacactacatctaacgaattaatagatgtaaattattcagatatt
tcttctcgttcttctgccaactctgttttaacttacacatctgaaagtacagattattat
ctagacaatgttgaagaagaattagaagaatctatttatactacccgaatttatgatctc
aaaaaggaagcaaaacgggttcgaaggaatagcaaaaaaaaaataaatgattttactaat
ataaaaagtcaagatgatcaatacaaaattacaacagacgaacaattatatgaaaaaaat
atcaatcaaaatactgaataccctcacaataatctttataataatccagaagcaaaaaat
gattctatatataatatggaatcacagctagctaatactcattatgaaaaaaacatacaa
attaaagccatagataatgtatccaaagtaaatgaacagattggtgacccaaataatata
gggatcaattcgattcctaataatactacaatacccatagatgcagattctataaaagat
agaacccattcttataataatgctataccagaaatgaaaaattataacaatgatacgaat
gaaaatgataaaactactactccacatactgaaattgatcataatttaaaaaataataat
attagtaagaaggcaaacaggattgttaaaaaatgtggaggtatcccaagtaaagaagaa
cccattttacctttttatgttatatgtgattatctagattttgtcgaaagaaaaatgtat
gtcaacagattcagatttaaattatatgatcctatttatcaattaggaaaatatcgaaat
tgttcaggggttatattaaaaagtgatttaaaaaaaagctgtttaaattatattgattcc
cattttttatttttaaaaaaagaattatgtaaaatagatttagatatagatattagatgc
ccaacaaaacaaatatttaaacatgtctgctataaaatgaatattgatcctactcatata
ttaatatatccttatcctcccctcaatagtccaatcaatttcatcccatataatatagat
tcatttacttgtccacctgaacatgacaacgattcatatcatgaatattctgataatatg
aattctaatgatcctagttatacagatgaaaatacaaattctgcatctggtcaaatttct
tttgaaactttaataaaacaacgtactatggaattagaacataattctttaactgagcag
aaaacattttgtttatctttattaccatttcattataaatattttacaagactatatcct
cacgattctccaaaatattttcattatgttattcaattatttaattcgcatgtacaatca
gtttctgcattcactggtcatattaaattgaaaaaatcgaaaaagaaatgtgccataggt
aatgataatgactcgaaatctaataattattacaacttagatgcagaaagtatcgattct
acatctagttcagataattctagtagcaccttagcaaacaatgaatatgattcaaatgat
tatactaccgttcaagatctaatagataaaatcaagttagaaatgaacccatatttaaaa
aaaaggggaatcaatccaaaacataaatttagattattatttaccttcggacctaaaatt
aaatatttgaacagcaacgaaccattgatacatctggattttgtaaaaacgaatcacatt
aaaaatgtatatgtaaccccactccgaatggagccagactttacggatcaacaaaagcaa
atgctcgaaatgaaccaactgaagataattcatgtttttaaccaaaccccatccaaagaa
gttttcggatacagttttgacgttttagtagagcctaatgatactatgctagaaataaag
aacaaaatacgaaagagaacaattttaccgaaatatatatttgacaaaataacattcttt
gaatatgaaaatgggcaaagaatttggagatctaacgatattataaactggaataacaag
caatttgccattatcattggagaacaccatgccccatcgcaatcaaaaccacagatagga
atgaaaatagcatag

DBGET integrated database retrieval system