KEGG   Plasmodium chabaudi: PCHAS_091620Help
Entry
PCHAS_091620      CDS       T01108                                 

Gene name
PC001130.02.0
Definition
(RefSeq) phosphoglycerate mutase, putative
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCHAS_091620 (PC001130.02.0)
   01230 Biosynthesis of amino acids
    PCHAS_091620 (PC001130.02.0)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCHAS_091620 (PC001130.02.0)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCHAS_091620 (PC001130.02.0)
Enzymes [BR:pcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PCHAS_091620 (PC001130.02.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PCHAS_091620 (PC001130.02.0)
  Exosomal proteins of melanoma cells
   PCHAS_091620 (PC001130.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNQENKFTGWTDVPLSEKGEQEAMSAGNYLKEKDFKFDIVYTSVL
KRAITTAWHVLKAGDLLHVPVIKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDNRWPGHHVVYKNVPKGVLPFTECLKDTVERVLPFWFDNIAPAILANKKVL
VTAHGNSLRGLVKHLDGLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatatactttagttcttctaaggcacggtgaaagcacatggaaccaagaaaac
aagttcacaggttggactgatgttcccttaagcgaaaagggagagcaagaagccatgtct
gctggaaattatttaaaggaaaaagattttaaatttgatatcgtttatacatctgtatta
aaaagagctattacaacagcatggcatgttttgaaagctggtgatcttttacatgtacca
gtcataaaaacatggagattaaatgagagacattatggttcattacaaggtttaaataaa
tccgaaactgctaaaaaatatggagaagaacaagttaaaatatggagaagatcttatgat
atcccccctccaaaattagataaagaagataatagatggccaggacaccatgtagtttat
aaaaatgtccccaaaggagtattgccatttactgaatgtttaaaagatacagtagaaaga
gttttacccttttggtttgataatattgcaccagctatattagcaaacaaaaaggtcctt
gtcactgcacatggaaacagtttaagaggattagttaaacacttagatggcttaagtgaa
gctgatgtattggaacttaacattccaacaggtgtaccattagtatatgaattagatgaa
aacttaaaaccaattaaacactactatttattagatagtgaagaattaaagaagaaaatg
gacgaagtagctaaccaaggaaaggcaaaataa

DBGET integrated database retrieval system