KEGG   Plasmodium chabaudi: PC001130.02.0Help
Entry
PC001130.02.0     CDS       T01108                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pcb  Plasmodium chabaudi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC001130.02.0
   01230 Biosynthesis of amino acids
    PC001130.02.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC001130.02.0
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC001130.02.0
Enzymes [BR:pcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PC001130.02.0
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PC001130.02.0
  Exosomal proteins of melanoma cells
   PC001130.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNQENKFTGWTDVPLSEKGEQEAMSAGNYLKEKDFKFDIVYTSVL
KRAITTAWHVLKAGDLLHVPVIKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDNRWPGHHVVYKNVPKGVLPFTECLKDTVERVLPFWFDNIAPAILANKKVL
VTAHGNSLRGLVKHLDGLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatatactttagttcttctaaggcacggtgaaagcacatggaaccaagaaaac
aagttcacaggttggactgatgttcccttaagcgaaaagggagagcaagaagccatgtct
gctggaaattatttaaaggaaaaagattttaaatttgatatcgtttatacatctgtatta
aaaagagctattacaacagcatggcatgttttgaaagctggtgatcttttacatgtacca
gtcataaaaacatggagattaaatgagagacattatggttcattacaaggtttaaataaa
tccgaaactgctaaaaaatatggagaagaacaagttaaaatatggagaagatcttatgat
atcccccctccaaaattagataaagaagataatagatggccaggacaccatgtagtttat
aaaaatgtccccaaaggagtattgccatttactgaatgtttaaaagatacagtagaaaga
gttttacccttttggtttgataatattgcaccagctatattagcaaacaaaaaggtcctt
gtcactgcacatggaaacagtttaagaggattagttaaacacttagatggcttaagtgaa
gctgatgtattggaacttaacattccaacaggtgtaccattagtatatgaattagatgaa
aacttaaaaccaattaaacactactatttattagatagtgaagaattaaagaagaaaatg
gacgaagtagctaaccaaggaaaggcaaaataa

DBGET integrated database retrieval system