KEGG   Plasmodium chabaudi: PC001155.02.0Help
Entry
PC001155.02.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pcb  Plasmodium chabaudi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PC001155.02.0
Exosome [BR:pcb04147]
 Exosomal proteins
  Proteins found in most exosomes
   PC001155.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
NNQKLTFCHLXLKEYSLAIEAAKKTKSLKTWREVNLVCVKYKQLKFAHVAGLQLIMHADH
LDEIIKIYEKKKYINELLSLLENGLNSERAHVGIYTELGMLYAKYKPEKLMEFIRSYTNK
MNTRKLIDVCHNEYLLKEAVYLYISYDEYNLAVDTIIKHSPIAYQPDIFMQVIHKVTNSD
IIHKVIDFYIEENPLNLYNLLKILENKIDNNRLVQTMKKSNNLPLIQKYLEDIQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
aataatcaaaaactgaccttttgtcatttanaattaaaggaatattcattagctatcgaa
gccgctaaaaaaacaaaaagtcttaaaacttggagagaagtaaacttagtatgtgtaaaa
tataaacaattaaaatttgcacatgtagcaggattgcaacttattatgcatgcagatcat
ttagatgaaatcataaaaatttatgaaaaaaaaaaatatataaatgaactattgagttta
ttggaaaacggactaaatagtgaaagggcgcatgtaggaatatatacagaattaggaatg
ttgtatgcaaaatataaaccagaaaaattaatggaatttataagaagttatactaataaa
atgaatacaaggaaactaatagatgtatgccataatgaatatttattaaaagaagctgta
tatttatatatatcatatgatgaatataacttagctgttgatacaattattaaacattca
cctattgcttatcaacctgatatatttatgcaagtaatacataaagtaacaaatagtgat
ataatacacaaagttatagatttttatattgaagaaaatccattgaatttatataattta
ttaaagattttagaaaataaaattgataacaatagattagtacaaacaatgaaaaaatca
aataatttgccattaatacaaaaatatttagaagatattcaa

DBGET integrated database retrieval system