KEGG   Plasmodium chabaudi: PCHAS_131870Help
Entry
PCHAS_131870      CDS       T01108                                 

Gene name
PC001255.02.0
Definition
(RefSeq) protein phosphatase 2b regulatory subunit, putative
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pcb  Plasmodium chabaudi
Brite
Protein phosphatases and associated proteins [BR:pcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PCHAS_131870 (PC001255.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 177 aa AA seqDB search
MGNTHAILSEKDQKDLLQAARFSEMDIKKMYKRFVELDTNKNGQLDPNELFDVPEISDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLMSTTDDFQKKKFAFDIYDINKDGMISNGELF
TVMKMMVGNNLNDVQLQQLVDRTIIQADKDGDGMISFEEFKDMISHIDVGNKLKLDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacacgcaatattatctgaaaaagaccaaaaggatttattgcaagccgct
cgttttagtgaaatggatattaaaaaaatgtataaaagatttgttgaactggatacaaat
aaaaacggacaactggatccaaatgaattatttgatgttcctgaaataagcgataatcca
ctagtaaaaagagttatatcgatatttgattcaaattcagatggaaaagtatcatttgtt
gaatttttagttggaataacgaaattaatgtcaaccacagacgattttcagaaaaaaaaa
ttcgcctttgatatctatgacataaacaaagatggaatgatttctaatggtgaattattt
accgttatgaaaatgatggttgggaataatttaaatgatgtacagctgcagcagctagtt
gatagaacaatcatacaagcagataaagacggggatggaatgatttcctttgaagaattt
aaagatatgatatcacacattgatgttgggaataaactcaagttagatttataa

DBGET integrated database retrieval system