KEGG   Plasmodium chabaudi: PC001255.02.0Help
Entry
PC001255.02.0     CDS       T01108                                 

Definition
protein phosphatase 2b regulatory subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pcb  Plasmodium chabaudi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 119 aa AA seqDB search
NPLVKRVISIFDSNSDGKVSFVEFLVGITKLMSTTDDFQKKKFAFDIYDINKDGMISNGE
LFTVMKMMVGNNLNDVQLQQLVDRTIIQADKDGDGMISFEEFKDMISHIDVGNKLKLDL
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
aatccactagtaaaaagagttatatcgatatttgattcaaattcagatggaaaagtatca
tttgttgaatttttagttggaataacgaaattaatgtcaaccacagacgattttcagaaa
aaaaaattcgcctttgatatctatgacataaacaaagatggaatgatttctaatggtgaa
ttatttaccgttatgaaaatgatggttgggaataatttaaatgatgtacagctgcagcag
ctagttgatagaacaatcatacaagcagataaagacggggatggaatgatttcctttgaa
gaatttaaagatatgatatcacacattgatgttgggaataaactcaagttagatttataa

DBGET integrated database retrieval system