KEGG   Plasmodium chabaudi: PCHAS_093170Help
Entry
PCHAS_093170      CDS       T01108                                 

Gene name
PC001358.02.0
Definition
(RefSeq) protein disulfide isomerase related protein, putative
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PCHAS_093170 (PC001358.02.0)
Enzymes [BR:pcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PCHAS_093170 (PC001358.02.0)
Chaperones and folding catalysts [BR:pcb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PCHAS_093170 (PC001358.02.0)
Membrane trafficking [BR:pcb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    PCHAS_093170 (PC001358.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
9
AA seq 423 aa AA seqDB search
MKLYGKIQFLLPVLYLFAKYASGLYANVKEIKTVDSLNEFDELLNSQKKCLVQFYATWCR
VSRGFSNDFINIAKTVKDDILVVAVKNEDIINKYKIQTYPNIQLFFTNDKKEKHIEQFDG
NYKIKDVVSFIYDNIKNYRLKELNIDVGKKDNSNKKNKKSKNSGKVITLNDSNFDQNVLK
DDDNVWFVFFYAPWCGHSKPIHPMFDELAKKTSHLKNARIAKIDATVEHRTAQTYEIKHY
PSFRLFPSGNKKPQTAIDYNESRTVNDLYQFFLKYYKEKKEILQLTSQSVFDEHCENDVC
LLAILPSKEDLEPSSLKSYIQILTSVIKDVNHLPVTLMWTHAGDQLDIVQKLNLTFGFPT
VIAISFSKNVYSILKGNYSEQSIKNFVIQMMTGKSSVDNLVPFKVNNVPKVDLNNMNEHN
SEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatatggaaaaatacagttcctactgcctgtactttacctttttgcaaaatat
gcaagtggcttatatgcaaatgtgaaagaaattaaaacagtagattcccttaacgaattt
gatgaattactaaattctcaaaaaaaatgcctcgttcaattttatgctacatggtgtcga
gtttccagaggattctctaacgatttcataaatatagcaaaaacagttaaagatgatata
ttagttgtagctgtaaaaaacgaagatataataaataaatataaaattcagacataccca
aatatacaactattttttaccaatgataaaaaagaaaagcatattgaacaatttgatgga
aattataaaataaaagatgttgtttcatttatatatgacaatattaaaaattatcgttta
aaagaattaaatattgatgttggtaaaaaggataattcaaataaaaaaaataaaaaaagt
aaaaatagtggtaaagtaattacattaaatgattctaattttgatcaaaatgttttaaaa
gatgatgataatgtatggttcgtttttttctatgccccatggtgtggacatagtaaacct
atacatccaatgtttgatgagctagctaaaaaaacatcacatttaaaaaatgcaagaata
gctaaaattgatgcaactgttgaacatagaacagcacaaacttacgaaataaagcattac
ccttctttccgtttattcccatcaggaaataaaaaaccacaaactgctatagattataat
gagtctagaactgttaatgatctttatcaattttttttaaaatattataaagaaaaaaaa
gaaatactacaattaacatctcaaagtgtttttgatgaacattgtgaaaatgatgtttgc
cttttagctatattaccaagtaaagaagatcttgaaccaagttctttaaaatcttatatt
caaatattaaccagtgtaataaaagatgttaaccatcttcctgttaccctaatgtggaca
cacgcaggagaccaattagatatagttcaaaaattaaatctaacattcggatttccaact
gttattgctattagtttttcaaaaaatgtttattcaattttaaaaggaaattattctgaa
caatcaatcaaaaatttcgttatacaaatgatgacaggaaaatcatcagtcgacaatttg
gttccatttaaagttaataatgtaccaaaggttgatctcaataatatgaatgagcataat
tcagaattataa

DBGET integrated database retrieval system