KEGG   Plasmodium chabaudi: PC001358.02.0Help
Entry
PC001358.02.0     CDS       T01108                                 

Definition
protein disulfide isomerase related protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pcb04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 153 aa AA seqDB search
FFLKYYKEKKEILQLTSQSVFDEHCENDVCLLAILPSKEDLEPSSLKSYIQILTSVIKDV
NHLPVTLMWTHAGDQLDIVQKLNLTFGFPTVIAISFSKNVYSILKGNYSEQSIKNFVIQM
MTGKSSVDNLVPFKVNNVPKVDLNNMNEHNSEL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttttttttaaaatattataaagaaaaaaaagaaatactacaattaacatctcaaagtgtt
tttgatgaacattgtgaaaatgatgtttgccttttagctatattaccaagtaaagaagat
cttgaaccaagttctttaaaatcttatattcaaatattaaccagtgtaataaaagatgtt
aaccatcttcctgttaccctaatgtggacacacgcaggagaccaattagatatagttcaa
aaattaaatctaacattcggatttccaactgttattgctattagtttttcaaaaaatgtt
tattcaattttaaaaggaaattattctgaacaatcaatcaaaaatttcgttatacaaatg
atgacaggaaaatcatcagtcgacaatttggttccatttaaagttaataatgtaccaaag
gttgatctcaataatatgaatgagcataattcagaattataa

DBGET integrated database retrieval system