KEGG   Plasmodium chabaudi: PC001358.02.0Help
Entry
PC001358.02.0     CDS       T01108                                 

Definition
protein disulfide isomerase related protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pcb  Plasmodium chabaudi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PC001358.02.0
Enzymes [BR:pcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PC001358.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 153 aa AA seqDB search
FFLKYYKEKKEILQLTSQSVFDEHCENDVCLLAILPSKEDLEPSSLKSYIQILTSVIKDV
NHLPVTLMWTHAGDQLDIVQKLNLTFGFPTVIAISFSKNVYSILKGNYSEQSIKNFVIQM
MTGKSSVDNLVPFKVNNVPKVDLNNMNEHNSEL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttttttttaaaatattataaagaaaaaaaagaaatactacaattaacatctcaaagtgtt
tttgatgaacattgtgaaaatgatgtttgccttttagctatattaccaagtaaagaagat
cttgaaccaagttctttaaaatcttatattcaaatattaaccagtgtaataaaagatgtt
aaccatcttcctgttaccctaatgtggacacacgcaggagaccaattagatatagttcaa
aaattaaatctaacattcggatttccaactgttattgctattagtttttcaaaaaatgtt
tattcaattttaaaaggaaattattctgaacaatcaatcaaaaatttcgttatacaaatg
atgacaggaaaatcatcagtcgacaatttggttccatttaaagttaataatgtaccaaag
gttgatctcaataatatgaatgagcataattcagaattataa

DBGET integrated database retrieval system